Gene Information

Name : Sbal678_0268 (Sbal678_0268)
Accession : YP_005271521.1
Strain : Shewanella baltica OS678
Genome accession: NC_016901
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 299851 - 300537 bp
Length : 687 bp
Strand : -
Note : KEGG: son:SO_4477 transcriptional regulatory protein CpxR; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing protein

DNA sequence :
ATGAGTCGGATATTATTAATCGATGACGATCTGGGTTTATCTGAGCTGCTAGGGCAACTGCTCGAGTTAGAAGGGTTTCA
GTTAACCTTGGCTTACGATGGTAAACAGGGTTTAGATCTGGCACTGAGTTCGGATTACGATCTGATCTTACTCGATGTCA
TGCTGCCTAAATTGAACGGCTTCGAAGTCCTGCGTGCACTGCGCCAACACAAGCAAACGCCTGTATTAATGCTGACCGCT
CGCGGCGATGAAATCGATCGCGTTGTTGGGCTTGAAATTGGCGCCGATGATTATCTGCCAAAGCCGTTTAATGACAGAGA
GTTAATCGCCCGTATCCGCGCCATTATTCGTCGTTCGAACTTAACAACCCAAGAAATCCATGCCGCACCAGCCCAAGAGT
TTGGCGATCTGCGCTTAGATCCATCGCGCCAAGAAGCTTACTGTAATGAGCAATTAATCATACTCACAGGCACAGAATTC
ACTCTGCTGCACACCCTTGCGCTGCACGCGGGAGAGTTGATGAATAAGGAAGAGTTAAACGAGAAAGTACTCGGCAAAAA
ACTCATGCCCTTCGATCGCAGCTTAGACATGCATTTATCGAATCTACGTAAAAAACTCCCCGAGCGTAGCGATGGGCGGC
CAAGGGTGAAAACCATCCGTGGCAAAGGTTATATTTGGCTCCCGTAA

Protein sequence :
MSRILLIDDDLGLSELLGQLLELEGFQLTLAYDGKQGLDLALSSDYDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELIARIRAIIRRSNLTTQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
TLLHTLALHAGELMNKEELNEKVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 7e-44 62
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 2e-43 61
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 3e-43 61
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 2e-43 61
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family BAC0533 Protein 3e-43 61
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 2e-43 61
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-46 59
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 2e-45 58
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-37 54
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-26 43
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-26 42
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 8e-23 41
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-26 41
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-21 41
Sbal678_0268 YP_005271521.1 two component transcriptional regulator, winged helix family VFG0596 Protein 8e-25 41