Gene Information

Name : GPOL_c12380 (GPOL_c12380)
Accession : YP_005281662.1
Strain : Gordonia polyisoprenivorans VH2
Genome accession: NC_016906
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1433168 - 1433854 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATACTCGTGGTCGACGACGATCGGGCCGTGCGTGAGTCGTTACGCCGATCACTCACCTTCAACGGCTACACCGT
CGACACCGCGGGTGACGGCATCGAAGCGCTGGAGAAGGTGGTTGCCGAGCGACCCGACGTCGCCATCCTGGATGTGATGA
TGCCGCGCCTCGACGGTCTGGAGGTGTGCCGGCGACTGCGTTCCACCGGCGATGACCTGCCGATTCTGGTGCTCACCGCA
CGCGACTCGGTGTCCGAGCGGGTGGCCGGCCTCGACGCCGGAGCCGATGACTACCTGCCCAAGCCGTTCGCGATGGAGGA
ACTCCTCGCACGTCTGCGAGCCCTGCTGCGTCGCGCGGCCCCCGAGGACGGCGCCGACTCGGAGACCCTGACGTTCGCGG
ATCTCTCACTCGACCCGGTGACCCGCGACGTCTACCGCGGCGAACGCCAGATCAGTCTGACGCGCACCGAGTTCGCGCTG
CTGGAAATGCTGATGGCAAATCCGCGGCGGGTGCTCTCGCGCAGCCGGATCCTCGAAGAGGTGTGGGGCTACGACTTCCC
GACCTCCGGTAATGCCCTCGAGGTCTACGTCGGCTACCTGCGGCGCAAGACCGAGGCCGACGGGGAGACCCGCTTGATCC
ACACCGTGCGCGGCGTCGGATACGTGCTGCGGGAGACGCCGCCGTAG

Protein sequence :
MRILVVDDDRAVRESLRRSLTFNGYTVDTAGDGIEALEKVVAERPDVAILDVMMPRLDGLEVCRRLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFAMEELLARLRALLRRAAPEDGADSETLTFADLSLDPVTRDVYRGERQISLTRTEFAL
LEMLMANPRRVLSRSRILEEVWGYDFPTSGNALEVYVGYLRRKTEADGETRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0083 Protein 3e-36 48
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0125 Protein 4e-36 46
GPOL_c12380 YP_005281662.1 two-component response regulator HE999704.1.gene1528. Protein 3e-39 46
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0638 Protein 2e-30 46
GPOL_c12380 YP_005281662.1 two-component response regulator AE000516.2.gene3505. Protein 2e-34 45
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0308 Protein 6e-33 44
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0197 Protein 1e-30 44
GPOL_c12380 YP_005281662.1 two-component response regulator U82965.2.orf14.gene. Protein 4e-26 43
GPOL_c12380 YP_005281662.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-35 42
GPOL_c12380 YP_005281662.1 two-component response regulator AE015929.1.gene1106. Protein 3e-31 41
GPOL_c12380 YP_005281662.1 two-component response regulator NC_012469.1.7685629. Protein 2e-30 41
GPOL_c12380 YP_005281662.1 two-component response regulator Y16952.3.orf35.gene. Protein 1e-28 41
GPOL_c12380 YP_005281662.1 two-component response regulator BAC0347 Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GPOL_c12380 YP_005281662.1 two-component response regulator VFG1390 Protein 1e-84 84
GPOL_c12380 YP_005281662.1 two-component response regulator VFG1386 Protein 3e-47 52
GPOL_c12380 YP_005281662.1 two-component response regulator VFG1389 Protein 6e-44 51
GPOL_c12380 YP_005281662.1 two-component response regulator VFG0596 Protein 1e-33 43