Gene Information

Name : MPD5_0645 (MPD5_0645)
Accession : YP_005319391.1
Strain : Melissococcus plutonius DAT561
Genome accession: NC_016938
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 707103 - 707804 bp
Length : 702 bp
Strand : +
Note : GI:332686791

DNA sequence :
ATGAAAAAAATCTTGGTTGTAGATGATGAAAAGCCAATTTCTGAAATTGTAAAATATAATTTAGTTAAAGAAGGCTATGA
AGTATATACGGCATTTGATGGAGAAGAAGCTTTAGAAAAAGTAACCGAAGTAGAACCCGATTTAGTTTTATTAGATTTAA
TGTTACCTAAAATGGATGGATTAGAGGTAGCAAGAGAAATCAGAAAAACATACAATATGCCAATTATTATGGTAACAGCT
AAGGATTCTGAAATTGATAAAGTATTAGGATTAGAGCTTGGTGCTGATGATTATGTAACAAAACCCTTTTCTAATCGTGA
GTTGGTGGCACGTGTCAAAGCAAACTTACGAAGAGAAGCATCAAGTGTCAAAGAGGAAGCGGGGAATCAATCCGAATTGA
CAATTGGAGATTTAACGATTCATCCAGATGCCTATATGGTATCAAAAGCAGGCGAAAATATTGAGTTAACGCATCGTGAA
TTTGAATTGCTTTATTATTTGGCTAGGCATTTAGGTCAAGTGATGACAAGAGAGCATCTTTTACAAACTGTTTGGGGATA
TGACTATTTTGGAGATGTTCGAACGGTGGATGTTACTGTTAGACGTTTGCGTGAGAAGATAGAAGATAGTCCAAGCCATC
CAAGTTACCTGGTTACCCGTCGAGGCGTTGGCTACTATCTTAGAAATCCCGAACAGGAGTAA

Protein sequence :
MKKILVVDDEKPISEIVKYNLVKEGYEVYTAFDGEEALEKVTEVEPDLVLLDLMLPKMDGLEVAREIRKTYNMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRREASSVKEEAGNQSELTIGDLTIHPDAYMVSKAGENIELTHRE
FELLYYLARHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPSYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MPD5_0645 YP_005319391.1 two-component response regulator NC_012469.1.7685629. Protein 2e-69 70
MPD5_0645 YP_005319391.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-52 56
MPD5_0645 YP_005319391.1 two-component response regulator NC_013450.8614421.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_007793.3914279.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_003923.1003749.p0 Protein 8e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_002745.1124361.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_009782.5559369.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_002951.3237708.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_007622.3794472.p0 Protein 5e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_002758.1121668.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator NC_009641.5332272.p0 Protein 7e-53 55
MPD5_0645 YP_005319391.1 two-component response regulator HE999704.1.gene2815. Protein 1e-45 54
MPD5_0645 YP_005319391.1 two-component response regulator NC_012469.1.7686381. Protein 1e-40 48
MPD5_0645 YP_005319391.1 two-component response regulator CP004022.1.gene3215. Protein 2e-38 48
MPD5_0645 YP_005319391.1 two-component response regulator AE000516.2.gene3505. Protein 9e-37 47
MPD5_0645 YP_005319391.1 two-component response regulator CP000034.1.gene3834. Protein 4e-34 47
MPD5_0645 YP_005319391.1 two-component response regulator CP000647.1.gene4257. Protein 2e-34 47
MPD5_0645 YP_005319391.1 two-component response regulator CP001138.1.gene4273. Protein 1e-34 47
MPD5_0645 YP_005319391.1 two-component response regulator NC_002695.1.915041.p Protein 4e-34 47
MPD5_0645 YP_005319391.1 two-component response regulator BAC0533 Protein 2e-34 47
MPD5_0645 YP_005319391.1 two-component response regulator AE016830.1.gene1681. Protein 3e-44 46
MPD5_0645 YP_005319391.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-39 46
MPD5_0645 YP_005319391.1 two-component response regulator AF155139.2.orf0.gene Protein 4e-38 46
MPD5_0645 YP_005319391.1 two-component response regulator HE999704.1.gene1528. Protein 6e-32 45
MPD5_0645 YP_005319391.1 two-component response regulator BAC0596 Protein 4e-29 44
MPD5_0645 YP_005319391.1 two-component response regulator BAC0039 Protein 2e-29 44
MPD5_0645 YP_005319391.1 two-component response regulator CP001138.1.gene2239. Protein 4e-29 44
MPD5_0645 YP_005319391.1 two-component response regulator CP000034.1.gene2186. Protein 2e-29 44
MPD5_0645 YP_005319391.1 two-component response regulator NC_002695.1.916589.p Protein 1e-29 44
MPD5_0645 YP_005319391.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-35 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-35 43
MPD5_0645 YP_005319391.1 two-component response regulator AF130997.1.orf0.gene Protein 8e-38 43
MPD5_0645 YP_005319391.1 two-component response regulator AM180355.1.gene1830. Protein 4e-39 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator AE015929.1.gene1106. Protein 6e-31 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-36 43
MPD5_0645 YP_005319391.1 two-component response regulator CP001918.1.gene3444. Protein 5e-28 43
MPD5_0645 YP_005319391.1 two-component response regulator NC_011595.7057856.p0 Protein 2e-28 42
MPD5_0645 YP_005319391.1 two-component response regulator NC_010410.6002989.p0 Protein 2e-28 42
MPD5_0645 YP_005319391.1 two-component response regulator NC_010400.5986590.p0 Protein 1e-27 42
MPD5_0645 YP_005319391.1 two-component response regulator CP000647.1.gene2531. Protein 8e-28 42
MPD5_0645 YP_005319391.1 two-component response regulator EU250284.1.orf4.gene Protein 7e-36 41
MPD5_0645 YP_005319391.1 two-component response regulator DQ212986.1.gene4.p01 Protein 6e-38 41
MPD5_0645 YP_005319391.1 two-component response regulator AF162694.1.orf4.gene Protein 1e-31 41
MPD5_0645 YP_005319391.1 two-component response regulator CP004022.1.gene1676. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MPD5_0645 YP_005319391.1 two-component response regulator VFG1386 Protein 5e-35 44
MPD5_0645 YP_005319391.1 two-component response regulator VFG1389 Protein 4e-30 44
MPD5_0645 YP_005319391.1 two-component response regulator VFG1702 Protein 5e-33 42
MPD5_0645 YP_005319391.1 two-component response regulator VFG1563 Protein 5e-33 41