Gene Information

Name : MRGA327_21415 (MRGA327_21415)
Accession : YP_005362009.1
Strain : Mycobacterium tuberculosis RGTB327
Genome accession: NC_017026
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3860130 - 3860456 bp
Length : 327 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGTCAGGTGGTTCATCGAGGAGGTACCCGCCGGAGCTGCGTGAGCGGGCGGTGCGGATGGTCGCAGAGATCCGCGGTCA
GCACGATTCGGAGTGGGCAGCGATCAGTGAGGTCGCCCGTCTACTTGGTGTTGGCTGCGCGGAGACGGTGCGTAAGTGGG
TGCGCCAGGCGCAGGTCGATGCCGGCGCACGGCCCGGGACCACGACCGAAGAATCCGCTGAGCTGAAGCGCTTGCGGCGG
GACAACGCCGAATTGCGAAGGGCGAACGCGATTTTAAAGACCGCGTCGGCTTTCTTCGCGGCCGAGCTCGACCGGCCAGC
ACGCTAA

Protein sequence :
MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRR
DNAELRRANAILKTASAFFAAELDRPAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 1e-16 55
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 1e-16 55
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 1e-16 55
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 1e-16 55
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 5e-14 54
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-14 53
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-14 53
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 3e-16 53
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 3e-16 53
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 3e-16 53
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 3e-16 53
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 4e-16 53
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-14 52
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 7e-14 52
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-14 52
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 7e-14 52
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-15 52
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1e-12 52
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-15 52
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 8e-15 52
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 3e-13 52
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-14 52
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-14 52
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 5e-13 52
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-13 52
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-12 51
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-12 51
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 7e-12 51
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 5e-12 51
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 5e-12 51
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 1e-14 45
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 5e-15 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MRGA327_21415 YP_005362009.1 putative transposase VFG1603 Protein 2e-14 54
MRGA327_21415 YP_005362009.1 putative transposase VFG0606 Protein 8e-14 52
MRGA327_21415 YP_005362009.1 putative transposase VFG0643 Protein 2e-14 52
MRGA327_21415 YP_005362009.1 putative transposase VFG1717 Protein 2e-12 51