Gene Information

Name : marA (UMN798_1588)
Accession : YP_005396908.1
Strain : Salmonella enterica 798
Genome accession: NC_017046
Putative virulence/resistance : Resistance
Product : multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1553831 - 1554220 bp
Length : 390 bp
Strand : -
Note : -

DNA sequence :
ATGACGATGTCCAGACGCAACACTGACGCTATTACTATTCATAGCATTTTGGACTGGATCGAGGATAACCTGGAGTCGCC
GCTCTCACTGGAAAAAGTGTCTGAGCGTTCAGGATATTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAGACCGGTC
ATTCATTAGGCCAATACATCCGCAGCCGTAAAATGACGGAAATCGCGCAAAAATTAAAAGAGAGCAACGAGCCCATTCTC
TATCTGGCGGAACGCTATGGCTTTGAGTCACAGCAAACATTGACCCGGACGTTCAAAAACTATTTTGATGTGCCGCCACA
CAAATACCGGATCACCAATATGCATGGCGAATCACGGTATATGCTGCCGCTGAACCATGGCAACTACTAG

Protein sequence :
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPIL
YLAERYGFESQQTLTRTFKNYFDVPPHKYRITNMHGESRYMLPLNHGNY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 6e-57 100
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 4e-54 96
marA YP_005396908.1 multiple antibiotic resistance protein MarA BAC0560 Protein 2e-53 96
marA YP_005396908.1 multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 2e-53 96
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 2e-52 95
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 8e-52 93
marA YP_005396908.1 multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 3e-21 43
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 6e-23 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP000034.1.gene4505. Protein 3e-19 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA BAC0371 Protein 2e-19 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 5e-20 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA NC_002695.1.914293.p Protein 2e-19 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 3e-20 42
marA YP_005396908.1 multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005396908.1 multiple antibiotic resistance protein MarA VFG1038 Protein 2e-21 43
marA YP_005396908.1 multiple antibiotic resistance protein MarA VFG0585 Protein 4e-20 42