Gene Information

Name : Q7S_06655 (Q7S_06655)
Accession : YP_005401142.1
Strain : Rahnella aquatilis HX2
Genome accession: NC_017047
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1456380 - 1457054 bp
Length : 675 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGAATACTGGTGATTGAAGACGATGTCAGTACAGGCGATTACCTGAAAAAAGGGCTGACAGAAGCAGGTTACAGCGT
AGATCTGGCGCGCAACGGTGCCGACGGCCTGTTTCTGGCGCTGGAAGAGGGTTACGACGCGGTGATCCTCGACGTCATGC
TGCCGGGGCTGAACGGCTGGCAGGTGATGGAAGTCCTGCGCAAAAAGAGCGACGTGCCGGTGCTGTTTCTCACCGCCCGC
GATGAAGTACAGGATCGCATTCACGGGCTGGAGCTGGGGGCTGACGACTATCTCATCAAACCGTTCTCCTTCACCGAACT
GGTGTTGCGTATCCGCACCTTGCTGCGCCGCCCGGCCGCCCGTGAGCCGGATGCGTATTCGGTGGCGGATCTGAATCTTG
ATGTGCTGCGCCGCCGCGTGACCCGTCAGGATCAGACCATCGCACTGACCAATAAGGAATTCATGTTGCTGCAGTTGCTG
ATGCGCCGTGAGGGTGAGGTTCTGTCGCGAACCATGATCGCCTCGCAGGTCTGGGATATGAATTTCGACAGCGATACCAA
TGTAGTGGATGTCGCCATTAAGCGTCTGCGTGCCAAGGTTGACCGCAGCTTTGAGGTGAAACTGATCCATACCGTGCGTG
GCATTGGTTACGTGTGCGAAGTGCGACATGAGTGA

Protein sequence :
MRILVIEDDVSTGDYLKKGLTEAGYSVDLARNGADGLFLALEEGYDAVILDVMLPGLNGWQVMEVLRKKSDVPVLFLTAR
DEVQDRIHGLELGADDYLIKPFSFTELVLRIRTLLRRPAAREPDAYSVADLNLDVLRRRVTRQDQTIALTNKEFMLLQLL
MRREGEVLSRTMIASQVWDMNFDSDTNVVDVAIKRLRAKVDRSFEVKLIHTVRGIGYVCEVRHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-56 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-55 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0125 Protein 1e-67 64
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0197 Protein 5e-68 64
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0638 Protein 2e-57 61
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0083 Protein 6e-64 60
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0308 Protein 4e-64 59
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0111 Protein 4e-63 57
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0347 Protein 2e-55 52
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein AE000516.2.gene3505. Protein 6e-30 43
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein HE999704.1.gene1528. Protein 5e-30 42
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002952.2859905.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_009641.5332272.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_013450.8614421.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007793.3914279.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_003923.1003749.p0 Protein 2e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002745.1124361.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_009782.5559369.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002951.3237708.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007622.3794472.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002758.1121668.p0 Protein 1e-30 41
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein U82965.2.orf14.gene. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG0596 Protein 4e-57 57
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1390 Protein 2e-40 44
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1386 Protein 4e-35 44
Q7S_06655 YP_005401142.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1389 Protein 5e-35 44