Gene Information

Name : RSPPHO_01520 (RSPPHO_01520)
Accession : YP_005417116.1
Strain : Rhodospirillum photometricum DSM 122
Genome accession: NC_017059
Putative virulence/resistance : Resistance
Product : Stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1828662 - 1829243 bp
Length : 582 bp
Strand : -
Note : -

DNA sequence :
ATGATGGCGATTTCGTTGAGCAAGGGCGGTAATGTCAGCCTGTCCAAGAGCGATCCCAGCTTGAAGCGGATCCTGATCGG
TCTGGGCTGGGACGTCCGCGCCACCGACGGCGCCGATTTCGACCTGGATGCCTCGGCTTTCCTGCTGGGTGCTACCGGTA
AGGTGCCCAATGACTCGGCTTTTATTTTTTACAACAACCTGAAGTCTGCCGATGGCTCGGTCGAGCATACGGGGGACAAC
CGCACAGGCGTGGGTGACGGCGACGACGAGGCGATCAAGGTCAATCTCGATCAGGTCTCGGCCGAGATCCAGACCATTGC
GATTACCGTCACCATTCACGAAGCCCAGGCGCGCCACCAGAGCTTTGGGCAGGTGCGTAACGCTTTCATTCGGGTCGTCA
ACGACGAAACCGGCGTCGAGATCGCCCGCTTCGATCTCAGCGAGGATTCCAGCACCGAAACGGCCATGGTGTTTGGCGAG
GTCTATCGTCACGGCGCCGAATGGAAGTTCCGGGCCGTGGGCCAAGGCTACGCCGGCGGTCTCGCCGCGATGTGCACCCA
GTACGGCATTAACGTGGGTTAA

Protein sequence :
MMAISLSKGGNVSLSKSDPSLKRILIGLGWDVRATDGADFDLDASAFLLGATGKVPNDSAFIFYNNLKSADGSVEHTGDN
RTGVGDGDDEAIKVNLDQVSAEIQTIAITVTIHEAQARHQSFGQVRNAFIRVVNDETGVEIARFDLSEDSSTETAMVFGE
VYRHGAEWKFRAVGQGYAGGLAAMCTQYGINVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-68 71
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-68 71
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-68 71
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-66 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 62
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSPPHO_01520 YP_005417116.1 Stress protein BAC0389 Protein 6e-68 71
RSPPHO_01520 YP_005417116.1 Stress protein BAC0390 Protein 1e-62 66
RSPPHO_01520 YP_005417116.1 Stress protein BAC0392 Protein 2e-23 41