Gene Information

Name : yycF (BANAU_3919)
Accession : YP_005423255.1
Strain : Bacillus amyloliquefaciens YAU B9601-Y2
Genome accession: NC_017061
Putative virulence/resistance : Virulence
Product : Transcriptional regulatory protein walR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4176021 - 4176731 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGATGGATAAGAAAATCCTTGTAGTCGATGATGAAAAACCGATTGCAGATATATTAGAGTTTAATTTAAGAAAAGAAGG
CTATGACGTGCATTGTGCGTACGACGGAAACGAAGCCGTGGAAATGGTGGAGGAGCTTCAGCCTGATTTAATTCTTTTAG
ATATTATGCTTCCGAATAAAGACGGAGTTGAAGTGTGCCGGGAAGTCCGGAAAAAATATGATATGCCGATTATTATGCTG
ACGGCAAAAGACTCGGAGATTGACAAGGTCATCGGGCTTGAAATCGGAGCGGATGACTATGTCACGAAGCCTTTCAGCAC
GCGTGAGCTTCTGGCCCGCGTCAAAGCGAACCTGCGCCGCCAGCTTACGGTTGCGCCGGCTGAGGAAGAATCAGCTTCTA
ATGACATTCATATCGGTTCTCTCGTCATCTTCCCTGACGCTTATGTCGTATCAAAAAGAGAAGAAACGATCGAGCTGACC
CATCGTGAGTTTGAATTGCTTCATTACTTAGCCAAACATATCGGACAGGTTATGACGCGTGAGCATCTGCTGCAGACTGT
GTGGGGCTATGACTATTTCGGTGACGTGAGAACGGTGGATGTAACAGTGCGCCGCCTTCGCGAGAAAATCGAGGATAATC
CGAGCCATCCGAACTGGATCGTCACAAGACGGGGTGTCGGTTATTACTTGAGAAACCCTGAACAGGACTAA

Protein sequence :
MMDKKILVVDDEKPIADILEFNLRKEGYDVHCAYDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIML
TAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTVAPAEEESASNDIHIGSLVIFPDAYVVSKREETIELT
HREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_012469.1.7685629. Protein 1e-65 68
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_009641.5332272.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_013450.8614421.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_007793.3914279.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002952.2859905.p0 Protein 3e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_003923.1003749.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002745.1124361.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_009782.5559369.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002951.3237708.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_007622.3794472.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002758.1121668.p0 Protein 2e-53 56
yycF YP_005423255.1 Transcriptional regulatory protein walR HE999704.1.gene2815. Protein 4e-47 52
yycF YP_005423255.1 Transcriptional regulatory protein walR AE016830.1.gene1681. Protein 4e-45 49
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_012469.1.7686381. Protein 3e-43 49
yycF YP_005423255.1 Transcriptional regulatory protein walR FJ349556.1.orf0.gene Protein 6e-40 47
yycF YP_005423255.1 Transcriptional regulatory protein walR HE999704.1.gene1528. Protein 5e-32 45
yycF YP_005423255.1 Transcriptional regulatory protein walR AF155139.2.orf0.gene Protein 9e-37 45
yycF YP_005423255.1 Transcriptional regulatory protein walR AM180355.1.gene1830. Protein 8e-39 45
yycF YP_005423255.1 Transcriptional regulatory protein walR AE000516.2.gene3505. Protein 5e-37 45
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_014475.1.orf0.gen Protein 8e-38 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_005054.2598277.p0 Protein 8e-38 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_007793.3914065.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002758.1121390.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_010079.5776364.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002952.2859858.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_007622.3794948.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_003923.1003417.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_013450.8614146.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002951.3238224.p0 Protein 3e-34 43
yycF YP_005423255.1 Transcriptional regulatory protein walR AF130997.1.orf0.gene Protein 2e-36 42
yycF YP_005423255.1 Transcriptional regulatory protein walR DQ212986.1.gene4.p01 Protein 8e-37 42
yycF YP_005423255.1 Transcriptional regulatory protein walR AE015929.1.gene1106. Protein 2e-29 42
yycF YP_005423255.1 Transcriptional regulatory protein walR CP001918.1.gene3444. Protein 3e-28 42
yycF YP_005423255.1 Transcriptional regulatory protein walR BAC0039 Protein 6e-29 42
yycF YP_005423255.1 Transcriptional regulatory protein walR BAC0596 Protein 2e-27 42
yycF YP_005423255.1 Transcriptional regulatory protein walR CP000034.1.gene2186. Protein 6e-29 42
yycF YP_005423255.1 Transcriptional regulatory protein walR NC_002695.1.916589.p Protein 5e-29 42
yycF YP_005423255.1 Transcriptional regulatory protein walR CP001138.1.gene2239. Protein 2e-27 42
yycF YP_005423255.1 Transcriptional regulatory protein walR AF162694.1.orf4.gene Protein 6e-33 41
yycF YP_005423255.1 Transcriptional regulatory protein walR CP001918.1.gene5135. Protein 7e-27 41
yycF YP_005423255.1 Transcriptional regulatory protein walR CP004022.1.gene3215. Protein 1e-34 41
yycF YP_005423255.1 Transcriptional regulatory protein walR CP004022.1.gene1676. Protein 6e-28 41
yycF YP_005423255.1 Transcriptional regulatory protein walR CP000647.1.gene2531. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_005423255.1 Transcriptional regulatory protein walR VFG1563 Protein 1e-31 43
yycF YP_005423255.1 Transcriptional regulatory protein walR VFG1389 Protein 1e-28 43
yycF YP_005423255.1 Transcriptional regulatory protein walR VFG1390 Protein 5e-35 42
yycF YP_005423255.1 Transcriptional regulatory protein walR VFG1702 Protein 1e-31 41