
|
Name : MARHY1941 (MARHY1941) Accession : YP_005429841.1 Strain : Marinobacter hydrocarbonoclasticus ATCC 49840 Genome accession: NC_017067 Putative virulence/resistance : Resistance Product : Mercuric transport protein (Mercury ion transport protein) Function : - COG functional category : - COG ID : - EC number : - Position : 1999392 - 1999748 bp Length : 357 bp Strand : - Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pt : transporter DNA sequence : ATGTCGAAATTCAAATCTAAATCCGGAGGTGCTTCTCTCGCTGTCGGGGGCATGGCTGGACTTCTCGCCTCGGCGTGCTG TCTCGGGCCATTGGTACTTATCACTCTGGGCGTTTCCGGTGCCTGGATCGGCAACCTGACAGCTTTGGAGCCCTATCGAC CGCTGTTCATTGGCGCGGCCACCTTCGCCATGTTCTTTGCCTGGCGACGAATCTATCGCCCTGTAGAGCAATGCTCACCC GGTGAAACGTGTGCGATCCCTCAAGTCCGAAAGACCTATAAGGTGATCTTTTGGGTAGTTACGGCTCTGGTACTGGTCGC ATTAGTGTTCCCTTACATTTTGCCTCTATTCTACTAA Protein sequence : MSKFKSKSGGASLAVGGMAGLLASACCLGPLVLITLGVSGAWIGNLTALEPYRPLFIGAATFAMFFAWRRIYRPVEQCSP GETCAIPQVRKTYKVIFWVVTALVLVALVFPYILPLFY |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merT | AAN62180.1 | mercuric transport protein MerT | Not tested | PAGI-2(C) | Protein | 2e-33 | 72 |
| merT | AET25400.1 | MerT | Not tested | PAGI-2(C) | Protein | 1e-33 | 71 |
| merT | AFG30123.1 | MerT | Not tested | PAGI-2 | Protein | 1e-33 | 71 |
| merT | AGK07024.1 | MerT | Not tested | SGI1 | Protein | 1e-33 | 71 |
| merT | AGK07082.1 | MerT | Not tested | SGI1 | Protein | 1e-33 | 71 |
| merT | YP_006098390.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-33 | 71 |
| unnamed | ABR13398.1 | mercuric transport protein | Not tested | PAGI-5 | Protein | 1e-31 | 71 |
| merT | ABQ57374.1 | MerT | Not tested | SGI1 | Protein | 1e-33 | 71 |
| merT | CAJ77063.1 | Mercuric ion transport protein | Not tested | AbaR1 | Protein | 8e-34 | 71 |
| merT | ACN81008.1 | MerT mercuric ion transport protein | Not tested | AbaR5 | Protein | 1e-33 | 71 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0233 | Protein | 7e-34 | 72 |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0695 | Protein | 5e-33 | 72 |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0691 | Protein | 2e-33 | 72 |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0692 | Protein | 3e-33 | 71 |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0693 | Protein | 5e-34 | 71 |
| MARHY1941 | YP_005429841.1 | Mercuric transport protein (Mercury ion transport protein) | BAC0690 | Protein | 1e-34 | 70 |