Name : emrE (MARHY2217) Accession : YP_005430114.1 Strain : Marinobacter hydrocarbonoclasticus ATCC 49840 Genome accession: NC_017067 Putative virulence/resistance : Resistance Product : multidrug resistance protein; DLP12 prophage Function : - COG functional category : - COG ID : - EC number : - Position : 2260278 - 2260610 bp Length : 333 bp Strand : + Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 1936950; Product type h : extrachromosomal origin DNA sequence : ATGAAAAGCTGGCTGCTTCTTGGTCTGGCCATTGTGGCCGAAGTGATTGCTACCTCGGCACTGAAATCCAGCGAAGGATT CACCCGGTTGATGCCGAGCGTTGTGGTCGTGATCGGTTACAGTGTGGCCTTCTATTTTCTGGCGCTGGCTATCAAGGTGA TCCCTGTGGGGATAGCCTATGCCGTCTGGGCCGGGCTGGGCATTGTATTAATTTCGCTCATTGGTTGGTTACTGCTCGGG CAAAAGCTGGATTTTCCTGCGGTTGTCGGTATGCTGCTGATTGTAGCCGGCGTTTTGGTTATCAACCTGCTTTCCAACAC AGGTGCACACTGA Protein sequence : MKSWLLLGLAIVAEVIATSALKSSEGFTRLMPSVVVVIGYSVAFYFLALAIKVIPVGIAYAVWAGLGIVLISLIGWLLLG QKLDFPAVVGMLLIVAGVLVINLLSNTGAH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 7e-27 | 67 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-26 | 67 |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 7e-27 | 67 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 7e-27 | 67 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-26 | 67 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 7e-27 | 67 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 7e-27 | 67 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-26 | 67 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 7e-27 | 67 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-26 | 67 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 7e-27 | 67 |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 7e-27 | 67 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 7e-27 | 67 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 7e-27 | 67 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 7e-27 | 67 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 7e-27 | 67 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 7e-27 | 67 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 7e-27 | 67 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-26 | 67 |
unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-16 | 45 |
unnamed | CAD42068.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-15 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0322 | Protein | 5e-31 | 70 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0324 | Protein | 2e-31 | 70 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0323 | Protein | 3e-27 | 67 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0377 | Protein | 1e-22 | 62 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | CP001138.1.gene1489. | Protein | 3e-27 | 62 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | CP004022.1.gene1549. | Protein | 1e-24 | 60 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | NC_002695.1.913273.p | Protein | 4e-24 | 60 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0150 | Protein | 6e-24 | 58 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | NC_010410.6003348.p0 | Protein | 2e-24 | 55 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0002 | Protein | 2e-24 | 55 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0192 | Protein | 8e-17 | 49 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0140 | Protein | 3e-15 | 45 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0329 | Protein | 5e-15 | 44 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0326 | Protein | 2e-14 | 42 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0139 | Protein | 3e-15 | 41 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | BAC0477 | Protein | 4e-10 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | VFG1586 | Protein | 1e-16 | 45 |
emrE | YP_005430114.1 | multidrug resistance protein; DLP12 prophage | VFG1587 | Protein | 1e-15 | 42 |