Gene Information

Name : CLDAP_04400 (CLDAP_04400)
Accession : YP_005440377.1
Strain : Caldilinea aerophila DSM 14535
Genome accession: NC_017079
Putative virulence/resistance : Virulence
Product : putative OmpR family two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 543840 - 544517 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGAGCGCATTCTCGTAGTGGAAGATGACCGCCGTATTCGCGATCTGTTGCGCCGCGGTCTCATCTTCGAAGGATA
CACTGTGGATACCGCCGAAGATGGCGAGACCGCGCTGCGCGTGGCGCGCGAGACGCCGCCGGATGCCGTCATCCTCGATA
TTATGCTGCCCAAGATGGACGGTCTGGAGGTCTGCCGTCGTCTGCGCAGCGCCTCCAATGTGCCGATCTTGATGCTGACG
GCGCGCGATTCGGTGCCAGATCGCGTCACCGGCCTGGACGCCGGCGCGGACGACTACATGGTCAAGCCCTTCGCCTTCGA
CGAGCTGCTGGCGCGCCTGCGCGCGCTCTTCCGCCGCCATCGTATGGAAAATGCGCCGGAGGTTTATCGCTACGCCGATC
TGGAGCTCAATCCGCGCACACGCCAGGTCTTTCGTGGAGGGCAGTTGATCGAGCTGACGGCCAAAGAATTCGACCTGCTG
GAGCTCTTTATGCGCCATCCTGGTCAGGTGCTCACGCGTGAGATGATCTACGAGCATATCTGGGATTATGACTTCGGCGG
CGAGAGCAACATTATCGAAGTGTATGTGCGCTATCTACGCAGCAAACTGGAGGCCGGCGGCAAACCGCGTCTGATCCAGA
CAGTGCGCGGCGTCGGCTATGCGTTGCGGGAAAGCTAA

Protein sequence :
MGERILVVEDDRRIRDLLRRGLIFEGYTVDTAEDGETALRVARETPPDAVILDIMLPKMDGLEVCRRLRSASNVPILMLT
ARDSVPDRVTGLDAGADDYMVKPFAFDELLARLRALFRRHRMENAPEVYRYADLELNPRTRQVFRGGQLIELTAKEFDLL
ELFMRHPGQVLTREMIYEHIWDYDFGGESNIIEVYVRYLRSKLEAGGKPRLIQTVRGVGYALRES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0111 Protein 6e-34 49
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0083 Protein 1e-33 49
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0125 Protein 1e-35 49
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0197 Protein 4e-33 49
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0638 Protein 2e-25 48
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0308 Protein 4e-31 46
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator AE000516.2.gene3505. Protein 7e-34 46
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002952.2859905.p0 Protein 5e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_009641.5332272.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_007622.3794472.p0 Protein 4e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_013450.8614421.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_007793.3914279.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_003923.1003749.p0 Protein 6e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002745.1124361.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_009782.5559369.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002951.3237708.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002758.1121668.p0 Protein 7e-34 45
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002952.2859858.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_007622.3794948.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_003923.1003417.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_013450.8614146.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002951.3238224.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_007793.3914065.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002758.1121390.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_010079.5776364.p0 Protein 6e-32 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator AE015929.1.gene1106. Protein 4e-29 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_002516.2.879194.p Protein 8e-18 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator BAC0347 Protein 6e-30 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator HE999704.1.gene1528. Protein 4e-36 43
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator AF155139.2.orf0.gene Protein 2e-27 43
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_012469.1.7685629. Protein 8e-28 42
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator NC_012469.1.7686381. Protein 2e-32 42
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator Y16952.3.orf35.gene. Protein 3e-19 42
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator HE999704.1.gene2815. Protein 3e-31 42
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator AE016830.1.gene1681. Protein 1e-29 41
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator CP001485.1.gene721.p Protein 5e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator VFG1390 Protein 1e-46 58
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator VFG1386 Protein 3e-40 47
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator VFG0596 Protein 7e-28 46
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator VFG1389 Protein 2e-37 44
CLDAP_04400 YP_005440377.1 putative OmpR family two-component response regulator VFG0473 Protein 5e-21 43