Gene Information

Name : CLDAP_00860 (CLDAP_00860)
Accession : YP_005440023.1
Strain : Caldilinea aerophila DSM 14535
Genome accession: NC_017079
Putative virulence/resistance : Virulence
Product : putative OmpR family two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 123277 - 123996 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAACGATAAAATCCTGGTTGTGGAAGATGAGATCTCACTGGTTGAAACGCTCGAATACTCGTTGCGCAAACAGGG
ATATGAAGTGATCACAGCCAACACAGGCCCCAGGGCACTGGAACAGGCGCGCCAACATCAACCTGATTTAATCATTCTCG
ACATCATGCTGCCTGGGCTGGATGGATTTGAAATCTGCCGTATCCTGCGCAAGGAGATGAATGCGCCGATTATCATGCTG
ACCGCGCGCACGGAAGAGGTTGATCGGGTTGTCGGGTTGGAGATGGGTGCAGATGACTATCTGACCAAGCCGTTCAGCAT
GCGCGAGCTGCTTGCGCGTGTGAAAGCGATGTTGCGTCGCGTGCGCATCGATCGCGAAGAAAACGCCGCCAACGCGACGC
TCAAGCCCGATGTCGTCGCTGAGCGCATGGTCTTCGACGATCTGGTGATCGATCTCAGCCGTCGCGAGGTGACATGCAAA
GGGGTCATTCATCACCTGAAGCCGAAAGAATTCGACCTGCTGGTCTTTCTGGCGCGCAACCGTGGAATCGTGCTCAGCCG
CGATCTGATCCTGGAGAGAGTGTGGGGCTGGGAGTTCGACGGCGGCAGCCGCACCGTGGACGTACACGTGCGTTGGCTGC
GCGAAAAGATCGAAGAGAATCCGTCCGATCCGCAGCGCATCATTACGGTGCGCGGCATCGGCTATCGGTTTGAGGGGTAA

Protein sequence :
MSNDKILVVEDEISLVETLEYSLRKQGYEVITANTGPRALEQARQHQPDLIILDIMLPGLDGFEICRILRKEMNAPIIML
TARTEEVDRVVGLEMGADDYLTKPFSMRELLARVKAMLRRVRIDREENAANATLKPDVVAERMVFDDLVIDLSRREVTCK
GVIHHLKPKEFDLLVFLARNRGIVLSRDLILERVWGWEFDGGSRTVDVHVRWLREKIEENPSDPQRIITVRGIGYRFEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-31 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator HE999704.1.gene2815. Protein 7e-49 48
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002952.2859905.p0 Protein 7e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_003923.1003749.p0 Protein 7e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002758.1121668.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_007622.3794472.p0 Protein 6e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_009641.5332272.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_013450.8614421.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_007793.3914279.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002745.1124361.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_009782.5559369.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002951.3237708.p0 Protein 8e-50 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator AE016830.1.gene1681. Protein 2e-52 47
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_012469.1.7685629. Protein 2e-46 46
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_012469.1.7686381. Protein 4e-50 45
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0111 Protein 4e-36 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator HE999704.1.gene1528. Protein 2e-34 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator AE000516.2.gene3505. Protein 2e-43 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0308 Protein 4e-33 42
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0083 Protein 2e-35 42
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0125 Protein 2e-32 42
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_008702.1.4607594. Protein 7e-33 42
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_013450.8614146.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002951.3238224.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_007793.3914065.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002758.1121390.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_010079.5776364.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_002952.2859858.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_007622.3794948.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_003923.1003417.p0 Protein 4e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0347 Protein 5e-32 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator AF155139.2.orf0.gene Protein 1e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator FJ349556.1.orf0.gene Protein 6e-38 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_014475.1.orf0.gen Protein 2e-36 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator NC_005054.2598277.p0 Protein 2e-36 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator AF130997.1.orf0.gene Protein 4e-33 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0197 Protein 5e-32 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator DQ212986.1.gene4.p01 Protein 5e-35 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator BAC0596 Protein 5e-33 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator CP001138.1.gene2239. Protein 5e-33 41
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator CP000034.1.gene3671. Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG0596 Protein 4e-32 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG1390 Protein 1e-36 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG1702 Protein 7e-39 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG1389 Protein 2e-34 43
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG1563 Protein 5e-39 42
CLDAP_00860 YP_005440023.1 putative OmpR family two-component response regulator VFG1386 Protein 5e-38 42