Gene Information

Name : PSMK_27250 (PSMK_27250)
Accession : YP_005446781.1
Strain : Phycisphaera mikurensis NBRC 102666
Genome accession: NC_017080
Putative virulence/resistance : Virulence
Product : OmpR family two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3249741 - 3250442 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGTCCGATCCCGCCCCCGCCCGCATCCTTCTCGTCGAGGACGAGCTCGACCTGCTCGAGCTCCTCCGCTTCAACCTCGA
GCGGGAGGGGTACGACGTGGTGGCGGCCCAGACCGGCGCCGCGGCGCTCGCCGCCGCCCGGGCCGAAGCCCTCGATCTCG
TCCTGCTCGACCGCATGCTCCCGGGCATGGAGGGCCTGGAGATCTGCCGCACGCTGCGCAAGCGCACCGAGACGGCGCGG
GTGCCGATCATCATGCTCACCGCCAAGGGCGAGGAGGCCGACGTCGTCAAGGGGCTCGAGGCCGGGGCGGACGACTACGT
CACCAAGCCGTTCTCGCCGCGGGTGCTGCTCGCGCGGATCCGCGCGGTGCTCCGCCGGGGCGAGGCGGGGGAGAACGATC
CCGCCAAGCTCAGCGCCGGCGGGGTGAGCCTCGACCGCGAGCGGCACGCGGTGACGGCCGACGGCGAGCCGGTGGACCTG
ACGGCGACGGAGTTCAAGCTGCTGGCGCTGCTGCTGTCGCGGCCCGGACGCGTCTTCACGCGTCAGCAGATCATCGAGCG
CATCCACGAAGGCTTCGCCGCCGTCACCGACCGTAGCGTGGACGTGCAGGTCGTCGCCCTGCGACGGAAGCTGCTCTCGC
GCGGCGATCGGCTCGAGACGGTCCGCGGGGTGGGCTATCGCTTCGCAGAAGACCGAGACTGA

Protein sequence :
MSDPAPARILLVEDELDLLELLRFNLEREGYDVVAAQTGAAALAAARAEALDLVLLDRMLPGMEGLEICRTLRKRTETAR
VPIIMLTAKGEEADVVKGLEAGADDYVTKPFSPRVLLARIRAVLRRGEAGENDPAKLSAGGVSLDRERHAVTADGEPVDL
TATEFKLLALLLSRPGRVFTRQQIIERIHEGFAAVTDRSVDVQVVALRRKLLSRGDRLETVRGVGYRFAEDRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 5e-19 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 5e-19 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 5e-19 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 5e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator AE000516.2.gene3505. Protein 9e-25 46
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator AE016830.1.gene1681. Protein 1e-25 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_003923.1003417.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_013450.8614146.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator AE015929.1.gene1106. Protein 1e-18 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002951.3238224.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_007793.3914065.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002758.1121390.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_010079.5776364.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002952.2859858.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_007622.3794948.p0 Protein 1e-21 44
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_010410.6002989.p0 Protein 6e-25 42
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_010400.5986590.p0 Protein 6e-25 42
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_011595.7057856.p0 Protein 6e-25 42
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_012469.1.7685629. Protein 3e-19 42
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002952.2859905.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_012469.1.7686381. Protein 1e-20 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_007793.3914279.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002758.1121668.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_007622.3794472.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_003923.1003749.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_009782.5559369.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002951.3237708.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002745.1124361.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_009641.5332272.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_013450.8614421.p0 Protein 2e-22 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator CP004022.1.gene3215. Protein 1e-18 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator BAC0197 Protein 2e-15 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator BAC0596 Protein 1e-24 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator CP001918.1.gene3444. Protein 9e-24 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator BAC0039 Protein 1e-24 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator CP001138.1.gene2239. Protein 1e-24 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator CP000647.1.gene2531. Protein 1e-23 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator CP000034.1.gene2186. Protein 1e-24 41
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator NC_002695.1.916589.p Protein 1e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSMK_27250 YP_005446781.1 OmpR family two-component system response regulator VFG1390 Protein 5e-19 42