Gene Information

Name : AMIS_80250 (AMIS_80250)
Accession : YP_005467761.1
Strain : Actinoplanes missouriensis 431
Genome accession: NC_017093
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8670151 - 8670843 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
GTGCAGCAGGTGGAGACGACCGAACGACGGGTTCTCGTGGTCGAGGACGAACGGGCGATCGCGGACGCCGTCGCGGCCCG
GCTGCGCGCCGAGGGCTTCGCCGTGCAGATCGCCGGCGACGGCCCGTCCGCGGTCGAGGCGGCCCGCACGACCCGGCCCG
ACGTCGTGGTGCTGGACGTGATGCTGCCCGGCTTCGACGGCCTCGAGGTGTGCCGCCGGATCCAGGCGGAACGGCCGGTG
CCGGTGCTCATGCTCACCGCCCGCGGCGACGAGACGGATCTGCTGGTCGGCCTCGCGGTCGGCGCGGACGACTACATGGC
GAAGCCCTTCTCGATGCGCGAGCTGGCCGCCCGGGTGCACGCCCTGCTCCGCCGCGCCGAGAAGATCACCGCGGCGCACG
AGAGCACGATCCGGCTCGGCGACCTGGAGATCAATCGGGCCGAGCGGCGAGTGCTGCGGGCCGGCGTCGAGGCGCATCTC
ACGCCGACCGAGTTCGACCTGCTCGTGCACCTGGCCGGGCGCCCGCGCACGGTGCTGCCCCGGGAGCGGCTGCTCGCCGA
GGTGTGGGGCTGGGCGGACGCATCGGGCACCCGCACGGTGGACAGCCACATCAAGGCTCTGCGGCGCAAGCTCGGCGCGG
ACCTGATCCGCACGGTGCACGGCGTGGGGTACGCGCTGGAGGTGGACCGATGA

Protein sequence :
MQQVETTERRVLVVEDERAIADAVAARLRAEGFAVQIAGDGPSAVEAARTTRPDVVVLDVMLPGFDGLEVCRRIQAERPV
PVLMLTARGDETDLLVGLAVGADDYMAKPFSMRELAARVHALLRRAEKITAAHESTIRLGDLEINRAERRVLRAGVEAHL
TPTEFDLLVHLAGRPRTVLPRERLLAEVWGWADASGTRTVDSHIKALRRKLGADLIRTVHGVGYALEVDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-21 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-20 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-17 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-16 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-16 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-16 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-16 41
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-12 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMIS_80250 YP_005467761.1 putative two-component system response regulator AE000516.2.gene3505. Protein 1e-34 46
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_002952.2859905.p0 Protein 9e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_002745.1124361.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_009782.5559369.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_002951.3237708.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_007622.3794472.p0 Protein 8e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_002758.1121668.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_009641.5332272.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_013450.8614421.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_007793.3914279.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_003923.1003749.p0 Protein 7e-31 44
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_012469.1.7685629. Protein 3e-27 43
AMIS_80250 YP_005467761.1 putative two-component system response regulator BAC0197 Protein 1e-22 42
AMIS_80250 YP_005467761.1 putative two-component system response regulator BAC0125 Protein 4e-25 41
AMIS_80250 YP_005467761.1 putative two-component system response regulator BAC0083 Protein 8e-24 41
AMIS_80250 YP_005467761.1 putative two-component system response regulator NC_012469.1.7686381. Protein 1e-26 41
AMIS_80250 YP_005467761.1 putative two-component system response regulator BAC0638 Protein 7e-19 41
AMIS_80250 YP_005467761.1 putative two-component system response regulator CP000647.1.gene2531. Protein 6e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMIS_80250 YP_005467761.1 putative two-component system response regulator VFG1390 Protein 1e-31 45
AMIS_80250 YP_005467761.1 putative two-component system response regulator VFG1389 Protein 3e-27 45
AMIS_80250 YP_005467761.1 putative two-component system response regulator VFG1702 Protein 1e-21 42
AMIS_80250 YP_005467761.1 putative two-component system response regulator VFG1563 Protein 1e-20 41
AMIS_80250 YP_005467761.1 putative two-component system response regulator VFG1386 Protein 6e-27 41