Gene Information

Name : AMIS_8730 (AMIS_8730)
Accession : YP_005460609.1
Strain : Actinoplanes missouriensis 431
Genome accession: NC_017093
Putative virulence/resistance : Virulence
Product : putative two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 934912 - 935610 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
TTGGACCGCATGAGAGCCCGGGTACTGGTCGTCGACGACGACCCCGCGTTGGCCGAGATGCTCGGCATCGTCCTGCGCAG
CGAAGGTTTCCTCCCCTCCTTCGTCGCGGACGGTGAACGTGCCCTGGCCGCCTTCCGGGAGAACCGTCCCGACATCGTTC
TGCTGGACCTGATGCTTCCCGGCATGAGCGGCATCGACGTGGCTCGCGCCATCCGAGCCGAGTCGGGCATCCCGATCGTC
ATGCTCACGGCCAAGAGCGACACCGTGGACGTGGTGCTGGGCCTGGAGTCCGGGGCCGACGACTACGTGGTCAAGCCGTT
CAAGCCCAAGGAGCTGGTGGCCCGGATGCGGGCCCGGCTGCGCCGGGGCGAGGACGCCGCGCCGGAGATGCTCACCATCG
GACCGCCCGGCAACCAGATCACCATCGACGTCCCGGCGCACACCGTGTCCCGCGACGGCGAGGAGGTCAAGCTGACCCCG
CTGGAGTTCGATCTGCTCGTCGCGCTGGCCCGCAAGCCGCGTCAGGTCTTCACCCGCGAGGTGCTGCTCGAGCAGGTCTG
GGGTTACCGGCACGCGGCCGACACCCGACTGGTGAATGTGCACGTCCAGAGGCTCCGGGCGAAGATAGAGCCCGACCCTG
AGCGGCCCGAGATCATCCTCACGGTGCGTGGAGTCGGCTACAAGGCCGGCACGGGCTAA

Protein sequence :
MDRMRARVLVVDDDPALAEMLGIVLRSEGFLPSFVADGERALAAFRENRPDIVLLDLMLPGMSGIDVARAIRAESGIPIV
MLTAKSDTVDVVLGLESGADDYVVKPFKPKELVARMRARLRRGEDAAPEMLTIGPPGNQITIDVPAHTVSRDGEEVKLTP
LEFDLLVALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKIEPDPERPEIILTVRGVGYKAGTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMIS_8730 YP_005460609.1 putative two-component system response regulator AE000516.2.gene3505. Protein 2e-79 76
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_012469.1.7685629. Protein 3e-44 47
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002952.2859905.p0 Protein 1e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002951.3237708.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_003923.1003749.p0 Protein 1e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002758.1121668.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_007622.3794472.p0 Protein 1e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_009641.5332272.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_013450.8614421.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_007793.3914279.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002745.1124361.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_009782.5559369.p0 Protein 2e-42 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002952.2859858.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_007622.3794948.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_003923.1003417.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_013450.8614146.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002951.3238224.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_007793.3914065.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002758.1121390.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_010079.5776364.p0 Protein 3e-38 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_012469.1.7686381. Protein 4e-41 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator BAC0125 Protein 2e-33 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator AE016830.1.gene1681. Protein 3e-43 43
AMIS_8730 YP_005460609.1 putative two-component system response regulator AE015929.1.gene1106. Protein 3e-33 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator HE999704.1.gene1528. Protein 4e-33 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator HE999704.1.gene2815. Protein 2e-40 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator CP001138.1.gene2239. Protein 5e-39 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator CP000034.1.gene2186. Protein 4e-39 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator NC_002695.1.916589.p Protein 3e-39 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator BAC0596 Protein 5e-39 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator BAC0039 Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMIS_8730 YP_005460609.1 putative two-component system response regulator VFG1389 Protein 4e-32 44
AMIS_8730 YP_005460609.1 putative two-component system response regulator VFG1390 Protein 2e-33 42
AMIS_8730 YP_005460609.1 putative two-component system response regulator VFG1563 Protein 1e-38 41
AMIS_8730 YP_005460609.1 putative two-component system response regulator VFG1702 Protein 1e-38 41