Gene Information

Name : emrE (APA07_21110)
Accession : YP_005487812.1
Strain : Acetobacter pasteurianus IFO 3283
Genome accession: NC_017121
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein EmrE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2295079 - 2295417 bp
Length : 339 bp
Strand : -
Note : Small multidrug resistance (SMR) family

DNA sequence :
ATGGTTTCCAAACCTTCCTTATACTTGGCGATTGCCATTGTATCTGAAGTTATCGGCACATCCTTGCTCACAGCCTCACA
GGGGTTTGCGCGCTGGGGATACGCTGTTGCCAGTCTGGCGGCGTATGGATGTGCCTTTTACTTTCTGTCTATCCCGCTCA
AAACCATTCCAACGGGCATTGTGTATGCCATCTGGAGCGGGGTGGGCATTGTGCTTGTTTCTGGCATTGGTGCTTTATTT
TTCAAGCAAATGCTGGATACGCCAGCCCTTATTGGCATTGGCCTGATTATGGTTGGGGTGTTGGTTATCAATCTGTTTTC
AGGTTCCATACAACATTAA

Protein sequence :
MVSKPSLYLAIAIVSEVIGTSLLTASQGFARWGYAVASLAAYGCAFYFLSIPLKTIPTGIVYAIWSGVGIVLVSGIGALF
FKQMLDTPALIGIGLIMVGVLVINLFSGSIQH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 2e-12 46
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 2e-12 46
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-12 46
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 2e-12 46
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-12 46
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-12 46
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-12 46
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-12 46
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-12 46
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-12 46
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 2e-12 46
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 2e-12 46
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-12 46
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 2e-12 46
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 2e-12 46
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-12 46
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 2e-12 46
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 2e-12 46
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 2e-12 46
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 2e-12 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0377 Protein 6e-16 55
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE NC_010410.6003348.p0 Protein 9e-15 55
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0002 Protein 9e-15 55
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE NC_002695.1.913273.p Protein 4e-13 54
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE CP001138.1.gene1489. Protein 7e-15 53
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0150 Protein 5e-13 53
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0324 Protein 2e-14 53
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE CP004022.1.gene1549. Protein 1e-12 51
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0322 Protein 1e-15 48
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0139 Protein 1e-11 46
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0323 Protein 7e-13 46
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0325 Protein 2e-09 44
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0140 Protein 1e-09 44
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0329 Protein 3e-09 42
emrE YP_005487812.1 quaternary ammonium compound-resistance protein EmrE BAC0327 Protein 2e-10 41