Gene Information

Name : TC41_1819 (TC41_1819)
Accession : YP_005518256.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1755439 - 1755804 bp
Length : 366 bp
Strand : -
Note : -

DNA sequence :
ATGCTGAACATCGGTGCTGGACCGGGAGAGTTGCGCGTGTACCTGGCTTGCGGCAGCACAGACATGCGCAAGTCCATCGA
CGGATTGGCGGCTCTGGTGCAGGAGTCGTTTCACCTGGACCCGTTTTCTCCCGCGGTGTTCGTGTTCTGTAACCGGGGGC
GGGACAAACTGAAGCTGCTGTACTGGGAGCACAACGGCTTCTGGCTGTATTATCGGCGGCTGGAGCGGGGCCGGTTTCAA
TGGCCGGACACAAGCGACGGCAAGACCCTCGTCATCAGCCACCGGGAGCTGAACTGGCTGTTGGACGGACTGCCATGGAA
CCAACCGAAAGCACACCGAAGGGTTACCGCGAAAAAAGTGGTGTGA

Protein sequence :
MLNIGAGPGELRVYLACGSTDMRKSIDGLAALVQESFHLDPFSPAVFVFCNRGRDKLKLLYWEHNGFWLYYRRLERGRFQ
WPDTSDGKTLVISHRELNWLLDGLPWNQPKAHRRVTAKKVV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 3e-17 45
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-14 45
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-14 45
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-11 44
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-15 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-15 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-15 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-15 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-15 44
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-15 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-15 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-15 44
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-15 44
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-15 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-15 44
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-15 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-15 44
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-14 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 43
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-14 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-14 43
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-16 42
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-16 42
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1517 Protein 7e-12 44
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1052 Protein 1e-15 44
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1709 Protein 9e-16 44
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1698 Protein 2e-15 44
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG0792 Protein 9e-16 44
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1737 Protein 6e-16 43
TC41_1819 YP_005518256.1 IS66 Orf2 family protein VFG1665 Protein 7e-16 41