Gene Information

Name : qseB (TC41_2540)
Accession : YP_005518956.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2401955 - 2402680 bp
Length : 726 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCTTGCTCGTCGAAGACGAGGTGCGGCTCGCGTCCGCACTCAAACAACTTCTCAAGGAACACCGATACGCCGT
CGACGTCGCCCACGACGGCGAAACCGGCTGCGATCTCGCCCTGACCGACAGCTACGACATCGCCATCCTCGACATCATGC
TGCCGAAGATAAGCGGTCTCGACATTCTGCGCGCCATGCGCAAGGCGGGCCTTCAAACGCCCGTACTGCTGCTCACAGCC
AAGGACACCGTCGAAGACCGCGTGACGGGCCTCGACGCCGGCGCTGACGATTACCTCGTCAAGCCGTTCGACAACAAGGA
GCTTTTGGCGCGCGTGCGGGCCCTCTCGCGACGCACCGGCCAGATTGCGGGCGGCGACGCCATCGAGGCGGGCCCGTTTC
GACTCGATCTTAACACTCGAACCGTGACGCGCAACGGGGAACCCCTGGCGCTGACCCCCAAGGAATTCCAGCTGCTTGAA
CTGTTCATGCGCAACCCCAACAAGGTGTTGTCCAAAGAGGTCATTCTCGATCGCGTCTGGGGACCCGATGCCGACGTGAT
TGGCAACGCGGTGGAAAACTACGTGCACTTCTTGCGGAAAAAATCGACGAGCCCGACTTGCCGTCGTACATCACCACCGT
GCGGAGCGTGGGATACATATTTCACCCGGACCCGTCGGCGGGCCGCAAGGCGTGAGAAGGGACGTGCGGCTTGTTTAAGC
GACTGA

Protein sequence :
MRILLVEDEVRLASALKQLLKEHRYAVDVAHDGETGCDLALTDSYDIAILDIMLPKISGLDILRAMRKAGLQTPVLLLTA
KDTVEDRVTGLDAGADDYLVKPFDNKELLARVRALSRRTGQIAGGDAIEAGPFRLDLNTRTVTRNGEPLALTPKEFQLLE
LFMRNPNKVLSKEVILDRVWGPDADVIGNAVENYVHFLRKKSTSPTCRRTSPPCGAWDTYFTRTRRRAARREKGRAACLS
D

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0347 Protein 8e-39 48
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-40 47
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-38 46
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-32 45
qseB YP_005518956.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 44
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-29 44
qseB YP_005518956.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-32 43
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-31 43
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-31 42
qseB YP_005518956.1 winged helix family two component transcriptional regulator BAC0288 Protein 1e-29 41
qseB YP_005518956.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-23 41
qseB YP_005518956.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_005518956.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-33 45
qseB YP_005518956.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-38 45