Gene Information

Name : vicR (TC41_3284)
Accession : YP_005519682.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3102002 - 3102694 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGCCTGCGCACATCCTGGTGGTCGAAGACGAGGAGCCCATCGCAAACATCCTCCGCTTTGCGCTGGAGCGAGAGGGATA
CCGCGTCTCCTGCGCGTACGACGGGGCGGAGGCCCTAGAGCGCTGGCGCGCCCTCCAGCCGGACCTGATCCTGCTCGACG
TGATGTTGCCGGAGGTGGATGGCTTCGATGTGCTGCGGGCGATCCGTCAGGCCTCGGGCGTCCCTGTGATCATCCTGACG
GCGAAAGACGACGAGGTGGACAAAGTGCTCGGGCTTGAACTTGGGGCGGACGACTACGTCACGAAGCCGTTCAGCACGCG
CGAGCTTGTGGCGCGCGTGAAGGCCAACCTTCGGCGTGCCTCGGACGTCCTGCGGGAACACAGGGAGAACGAGCGGTACG
TGGTGCAGGATCTGGTGATTGACCTCGCCGAATACACCGTAACCAAGGGAGGACAGCCGATTCCGCTCACACACCGAGAG
TTTCAGGTGCTCGCTGTGCTCGCCGCGCATCCGGGCCGCGTCTTCACGCGCGATCAGCTGGTGGACCAGGTCTGGGGCAC
CGATTACGTGGGCGACACCCGCGCGGTGGACGTGACCATCCGCCGGTTGAGGGAAAAGCTGGAACCCGATCCGAGCCAGC
CGCGTTACGTGCTGACGCGCCGAGGCGTCGGGTACTATGTGAGGAATGAGTGA

Protein sequence :
MPAHILVVEDEEPIANILRFALEREGYRVSCAYDGAEALERWRALQPDLILLDVMLPEVDGFDVLRAIRQASGVPVIILT
AKDDEVDKVLGLELGADDYVTKPFSTRELVARVKANLRRASDVLREHRENERYVVQDLVIDLAEYTVTKGGQPIPLTHRE
FQVLAVLAAHPGRVFTRDQLVDQVWGTDYVGDTRAVDVTIRRLREKLEPDPSQPRYVLTRRGVGYYVRNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-36 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-60 56
vicR YP_005519682.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-47 49
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 48
vicR YP_005519682.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-42 47
vicR YP_005519682.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-45 45
vicR YP_005519682.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-41 44
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-35 43
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-33 43
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-29 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 7e-30 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-38 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 7e-30 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-38 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-28 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-33 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-28 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-32 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-36 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-39 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-35 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-30 45
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-35 43
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-37 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-32 42
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-34 41
vicR YP_005519682.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-32 41