Gene Information

Name : yceC (LL3_00274)
Accession : YP_005544055.1
Strain : Bacillus amyloliquefaciens LL3
Genome accession: NC_017190
Putative virulence/resistance : Resistance
Product : tellurium resistance protein-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 267574 - 268170 bp
Length : 597 bp
Strand : +
Note : -

DNA sequence :
ATGGCGATCTCTTTACAAAAAGGACAGCGAATTGATTTAACAAAAGGAAAAGCAGGCCTGTCAAAACTGCTGGTCGGATT
GGGCTGGGACCCTGTATCATCGGGCGGCTTTTTCGGAAAGCTGTTCGGCGGAGGCGGTGCCAATATCGACTGTGACGCTT
CCGTACTGATGCTTGAAAATGATAAAATGACAGACAGCAAAAACGTCATCTATTTCGGCAACCTGAAAAGCCGGTGCGGC
GGTGTCGTACATACGGGTGACAACCTGACGGGAGAAGGCGACGGCGATGATGAACAAATTCTCATCGACTTGGCGAAAGT
GCCCGCACAGATTAATAAACTTGTATTTGTCGTCAATATTTATGACTGCGTCAGACGCAAACAGGACTTCGGCATGATTC
AAAACGCGTTCATCCGCGTCGTTGATCAATCTAACCGCGAAGAATTGGTGACTTACAATTTAAGAGATAACTATTCAGGC
AAGACGAGCCTGATCGCGGCTGAAATCTACCGTCAGGACGGCGAGTGGAAATTCGCCGCAGTAGGAGAAGGCACAAACGA
TACAAAAATCGGCGATATCGTTAACCGATACGCCTAA

Protein sequence :
MAISLQKGQRIDLTKGKAGLSKLLVGLGWDPVSSGGFFGKLFGGGGANIDCDASVLMLENDKMTDSKNVIYFGNLKSRCG
GVVHTGDNLTGEGDGDDEQILIDLAKVPAQINKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNREELVTYNLRDNYSG
KTSLIAAEIYRQDGEWKFAAVGEGTNDTKIGDIVNRYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-33 46
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-33 46
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-33 46
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-37 46
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-28 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-28 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 43
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-34 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-34 43
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceC YP_005544055.1 tellurium resistance protein-like protein BAC0390 Protein 2e-34 45
yceC YP_005544055.1 tellurium resistance protein-like protein BAC0389 Protein 7e-34 44
yceC YP_005544055.1 tellurium resistance protein-like protein BAC0392 Protein 6e-28 43