Gene Information

Name : yvrH (BAXH7_01625)
Accession : YP_005549611.1
Strain : Bacillus amyloliquefaciens XH7
Genome accession: NC_017191
Putative virulence/resistance : Resistance
Product : two-component response regulator YvrH
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1534334 - 1535041 bp
Length : 708 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGTCGCAGACTCAAAGCAAAGTATTAATAATAGATGACGAAAGAGAAATTTTGGAACTGATCAAAACCGTATTAATAAG
AGAAGGCATTGATCGCGTGATTACAGCTTCTACTGCCCGTGATGGATTGGCTCAATTTCATCAAGAAAATCCAGATCTGG
TTATATTGGATATCATGCTCCCAGACGGTGAAGGCTATGATATCTGTAAGCAAATAAGAGATATTTCACATGTTCCGATT
ATTTTTTTGTCTGCAAAAGGAGAGGAAACGGACAAAATTGTAGGACTTGCCATCGGTGGGGACGACTACATTACAAAACC
CTTCAGCCCTAAGGAAGTCGCATATCGGGTCAAAGCACAGCTAAGAAGATCTTCTTACTTACAGCCATCTCAAACCGACA
CCCTGATAAAAGCAGGGCCCTTTGAATTACATCAGCAGCAAGCCGAGCTCACCAAAAACGGAGCGGCTATTGAGTTAACA
CCTAAAGAACTCATGCTCATGACATATTTTTTGCAGCATCCCAATCGGGTGATCAGTAAAGAAACACTTTATCAAGCTGT
ATGGGGAGAAGATTTCTTCGGTTCTGACAATACGGTGATGGTTCATATACGCAGACTCCGGGAGAAAATAGAAACCATCC
CATCCACACCAGACTTTCTCGTCACTGTAAAAGGGTTAGGCTACAAATTTGTTGTAAAGGATGCTTAA

Protein sequence :
MSQTQSKVLIIDDEREILELIKTVLIREGIDRVITASTARDGLAQFHQENPDLVILDIMLPDGEGYDICKQIRDISHVPI
IFLSAKGEETDKIVGLAIGGDDYITKPFSPKEVAYRVKAQLRRSSYLQPSQTDTLIKAGPFELHQQQAELTKNGAAIELT
PKELMLMTYFLQHPNRVISKETLYQAVWGEDFFGSDNTVMVHIRRLREKIETIPSTPDFLVTVKGLGYKFVVKDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 9e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yvrH YP_005549611.1 two-component response regulator YvrH DQ212986.1.gene4.p01 Protein 2e-36 46
yvrH YP_005549611.1 two-component response regulator YvrH AF130997.1.orf0.gene Protein 2e-35 45
yvrH YP_005549611.1 two-component response regulator YvrH AE016830.1.gene1681. Protein 2e-37 44
yvrH YP_005549611.1 two-component response regulator YvrH FJ349556.1.orf0.gene Protein 1e-38 44
yvrH YP_005549611.1 two-component response regulator YvrH NC_012469.1.7685629. Protein 5e-40 44
yvrH YP_005549611.1 two-component response regulator YvrH AM180355.1.gene1830. Protein 5e-37 44
yvrH YP_005549611.1 two-component response regulator YvrH AF155139.2.orf0.gene Protein 9e-38 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_002952.2859905.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_002951.3237708.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_003923.1003749.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_002758.1121668.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_007622.3794472.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_009641.5332272.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_013450.8614421.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_007793.3914279.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_002745.1124361.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_009782.5559369.p0 Protein 2e-40 43
yvrH YP_005549611.1 two-component response regulator YvrH AF162694.1.orf4.gene Protein 2e-33 43
yvrH YP_005549611.1 two-component response regulator YvrH AF253562.2.orf0.gene Protein 2e-27 43
yvrH YP_005549611.1 two-component response regulator YvrH EU250284.1.orf4.gene Protein 3e-34 43
yvrH YP_005549611.1 two-component response regulator YvrH NC_005054.2598277.p0 Protein 7e-34 42
yvrH YP_005549611.1 two-component response regulator YvrH NC_014475.1.orf0.gen Protein 7e-34 42
yvrH YP_005549611.1 two-component response regulator YvrH NC_012469.1.7686381. Protein 4e-34 41