Gene Information

Name : ABLL_0579 (ABLL_0579)
Accession : YP_005552771.1
Strain : Arcobacter sp. L
Genome accession: NC_017192
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 573996 - 574664 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
ATGAAAATATTAATAATTGAAGACGATATAAAAATCATAAACTTTTTGAAAAAAGGTTTAGAAGAAGAGTGTTACATAGT
TGATTTCTCAACAAATGGTGATGAGGGATTATATTTAGCTAATGTTAACTCTTATGACTTAATTTTACTTGATATTATGC
TTCCAATAAAAGATGGAATTGAAGTATGCAAAAGTTTAAGAAGTTCAAATATTCAAACCCCAATAATAATGCTTACAGCA
AAAGATTCTATTGAAGATAAAATCAAAGGATTAGATATTGGAGCAAATGATTATTTAGCAAAACCTTTTTCCTTTGCCGA
ATTACTTGCACGAATTAGAGTTCAATTAAGAATGACAACAACTACTCAAACTAAACTACAAATTGCAGATTTAGAACTTG
ATTTATTAAACAAAACAGCCACAAGAGCAAAAGAAAATATAAATTTGACAGCTAAAGAGTTTACACTTCTTGAATATCTA
ATAAAAAACAAAAATAGAGTTTTAAGTGAAACAACAATCAATGAAGCACTTTCTTCTTTTGAAGATTCTAATATTAGTAA
TATTGTAAATGTTTATATTTATAGATTAAGAAATAAAATTGATAAGAATTTTGAAAAAAAACTTATAAAAACAGTTAGAG
GAATAGGATTTAAAATAAGTGAAGATTAA

Protein sequence :
MKILIIEDDIKIINFLKKGLEEECYIVDFSTNGDEGLYLANVNSYDLILLDIMLPIKDGIEVCKSLRSSNIQTPIIMLTA
KDSIEDKIKGLDIGANDYLAKPFSFAELLARIRVQLRMTTTTQTKLQIADLELDLLNKTATRAKENINLTAKEFTLLEYL
IKNKNRVLSETTINEALSSFEDSNISNIVNVYIYRLRNKIDKNFEKKLIKTVRGIGFKISED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-44 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-43 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABLL_0579 YP_005552771.1 two-component response regulator BAC0125 Protein 5e-45 46
ABLL_0579 YP_005552771.1 two-component response regulator BAC0111 Protein 2e-45 46
ABLL_0579 YP_005552771.1 two-component response regulator BAC0197 Protein 2e-42 46
ABLL_0579 YP_005552771.1 two-component response regulator BAC0638 Protein 5e-36 45
ABLL_0579 YP_005552771.1 two-component response regulator BAC0083 Protein 2e-42 44
ABLL_0579 YP_005552771.1 two-component response regulator BAC0308 Protein 2e-40 44
ABLL_0579 YP_005552771.1 two-component response regulator BAC0347 Protein 2e-42 43
ABLL_0579 YP_005552771.1 two-component response regulator AE016830.1.gene1681. Protein 1e-31 43
ABLL_0579 YP_005552771.1 two-component response regulator HE999704.1.gene1528. Protein 4e-28 42
ABLL_0579 YP_005552771.1 two-component response regulator NC_002758.1121390.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_010079.5776364.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_002952.2859858.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_007622.3794948.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_003923.1003417.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_013450.8614146.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_002951.3238224.p0 Protein 9e-30 41
ABLL_0579 YP_005552771.1 two-component response regulator NC_007793.3914065.p0 Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABLL_0579 YP_005552771.1 two-component response regulator VFG0596 Protein 1e-44 46