Gene Information

Name : yceE (I33_0332)
Accession : YP_005555326.1
Strain : Bacillus subtilis RO-NN-1
Genome accession: NC_017195
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 299880 - 300458 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACGAAAACAAATCCGGGACTGACAAAAGCGGTGATCGGCTT
AGGCTGGGATACAAACAAGTACTCCGGCGGACACGATTTTGACCTGGATGCTTCGGCCTTTTTAGTTGATGCGCATGATA
ACTGCGTAAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACATCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGCACGGGTGAGGGCGACGGAGATGATGAGCAGATTATCGTTGATTTCTCAAAAATCCCTGCTCACATTGAGAAAATCGG
CATCACAGTGACCATTCACGACGCTGAAGCACGCAGCCAAAACTTTGGACAAGTTTCCAATGCATTTGTCCGCGTTGTGG
ATGAAGAAACGCAGAATGAGCTTCTTCGCTTCGACTTGGGAGAAGACTTCTCTATTGAAACAGCTGTTGTCGTTTGTGAG
CTTTACAGACACGGCGGCGAGTGGAAATTCAATGCGATCGGCAGCGGTTTTTCCGGCGGACTGGCTGCATTGTGCCGGAA
TTACGGTTTGCAAGTGTAA

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCE
LYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-51 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_005555326.1 tellurium resistance protein TerD BAC0390 Protein 2e-51 55
yceE YP_005555326.1 tellurium resistance protein TerD BAC0389 Protein 5e-52 54