Gene Information

Name : YBT020_02535 (YBT020_02535)
Accession : YP_005564175.1
Strain : Bacillus thuringiensis YBT-020
Genome accession: NC_017200
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 530124 - 530708 bp
Length : 585 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCATCAATTTCATTGAAAAAAGGACAAAAGGTAGACTTAACAAAAACGAATCCAGGTCTTTCAAAAGTTCTTGTAGG
ACTTGGTTGGGATACAAATCGTTATGATGGACAAGCTGATTTTGATTTAGATGTTAGTATTTTCTTAGTAGGTGCGAACG
GTAAAGTTTCAGGTGCAGAGGATTTCGTTTTCTATAATAATCCAAAAGGCGCAAATGGTGCTGTAGAGCATTTAGGAGAT
AACCGAACTGGCGAAGGTGAAGGCGATGATGAATCTATCAAAGTAGATTTGAAAAATGTACCTGCACATATCGAACGTAT
TTGCTTCACAATCACAATTTACGATGGAGAAGGACGCAGCCAAAACTTCGGACAAGTTTCTAACTCTTTCGTACGTATTT
TAGATGAAGAAAAGAATGCAGAGTTAATTCGTTACGATTTAGGAGAAGATTTCTCTATTGAAACAGCGGTTGTAGTAGGT
GAATTATACCGTCATGCAGGTGAATGGAAGTTCAATGCAATCGGAAGTGGATTCCAAGGTGGATTAGCGTCTCTATGTAA
TAACTTTGGTTTAGACGTAGAGTAA

Protein sequence :
MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQADFDLDVSIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGD
NRTGEGEGDDESIKVDLKNVPAHIERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVG
ELYRHAGEWKFNAIGSGFQGGLASLCNNFGLDVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-51 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-54 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-49 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YBT020_02535 YP_005564175.1 tellurium resistance protein BAC0389 Protein 2e-55 57
YBT020_02535 YP_005564175.1 tellurium resistance protein BAC0390 Protein 3e-53 55