Gene Information

Name : YBT020_02540 (YBT020_02540)
Accession : YP_005564176.1
Strain : Bacillus thuringiensis YBT-020
Genome accession: NC_017200
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 530788 - 531366 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCCATTCAGTTACAAAAAGGACAGAAAATCGATTTAGGTAAAACAAGCCCTGGCTTAACGAAAGCAGTAATTGGTCT
TGGTTGGGATATTAAATCTTATGATGGTGGAGCTGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGTGAACGGAA
AATGTACGAAGGAAACTGATTTTATCTTCTATAACAATTTACAGTCTCCTTGTGGATCTGTTCTGCATACAGGAGATAAT
CGTACAGGTGAAGGTGAAGGCGACGATGAGCAACTTGTTGTGGACTTAAAGAAAGTTCCAGCAGATGTGCACAAAATTGC
TATTACAGTTACAATTTATGATGCAGAAGGCCGTAGTCAAAACTTTGGACAAGTAGGAAATGCATTCGTTCGTTTAGCGA
ATGAAGAAACGAATGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATCGAAACAGCAGTTGTCTTTTGTGAA
TTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGTGGATTCCAAGGTGGCTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MAIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDASAFLLDVNGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHKIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-48 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-44 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-44 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-43 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-42 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-39 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YBT020_02540 YP_005564176.1 tellurium resistance protein BAC0389 Protein 3e-44 58
YBT020_02540 YP_005564176.1 tellurium resistance protein BAC0390 Protein 1e-42 54