Gene Information

Name : BJ6T_11260 (BJ6T_11260)
Accession : YP_005606006.1
Strain : Bradyrhizobium japonicum USDA 6
Genome accession: NC_017249
Putative virulence/resistance : Virulence
Product : phosphate regulon, two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1203357 - 1204064 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGCACGCATTATGGTGGTTGAGGACGAGGAAGCTCTCACCGAGCTTCTCCGCTACAACCTCGAAGGCGACGGCTA
TGACGTCGAGACGGTGATGCGCGGCGACGACGCCGACACCCGCCTCAAGGAGCACATCCCCGATTTGATCGTGCTCGACT
GGATGCTGCCGGGCCTCTCCGGCATCGAGCTGTGCCGGCGGCTGCGCACCCGGCCCGAGACCAAGCAGCTTCCGATCATC
ATGCTCACCGCGCGCGGCGAGGAGAGTGAGCGGGTGCGGGGTCTTGCGACCGGCGCCGACGACTACATCGTCAAGCCGTT
CTCGGTGCCGGAGCTGCTGGCACGCGTGAAGGGCCTGCTCAGGCGCGCCAGCCCGGAGCGGCTCGCCACCGTGCTCGCCT
ATGGCGACATCGAACTCGACCGCGACAAGCGCCGCGTGGCGCGTTCGGGCCGGCCGATCGATCTCGGCCCGACCGAATAT
CGCCTGCTGGAGTTCTTTCTGGAGCATCCCGGCCGCGTGTTCTCGCGCGAGCAGCTGCTCGACAGCGTCTGGGGCCGTGA
CATCTACATCGACGAGCGCACCGTCGACGTCCATATCGGCCGCCTGCGCAAGCTGCTCAATCTCGGTCGCGAGCAGGACC
CGATCCGCACCGTCCGCGGCGCGGGCTACGCACTGGACGATCGCTTTGCGAAGGCGGAGCAGGCGTAA

Protein sequence :
MGARIMVVEDEEALTELLRYNLEGDGYDVETVMRGDDADTRLKEHIPDLIVLDWMLPGLSGIELCRRLRTRPETKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLATVLAYGDIELDRDKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNLGREQDPIRTVRGAGYALDDRFAKAEQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator AE000516.2.gene3505. Protein 6e-35 44
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator CP001918.1.gene3444. Protein 9e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator BAC0039 Protein 7e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator BAC0596 Protein 6e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_002695.1.916589.p Protein 5e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator CP000034.1.gene2186. Protein 7e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator CP001138.1.gene2239. Protein 6e-35 43
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_010410.6002989.p0 Protein 3e-37 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_010400.5986590.p0 Protein 2e-36 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_011595.7057856.p0 Protein 3e-37 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_002952.2859905.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator HE999704.1.gene2815. Protein 2e-37 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_009782.5559369.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_002951.3237708.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_007622.3794472.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_002758.1121668.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_009641.5332272.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_013450.8614421.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_007793.3914279.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_003923.1003749.p0 Protein 3e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator NC_002745.1124361.p0 Protein 2e-41 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator CP000647.1.gene2531. Protein 4e-35 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator HE999704.1.gene1528. Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator VFG1390 Protein 1e-38 45
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator VFG1563 Protein 1e-33 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator VFG1702 Protein 5e-34 42
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator VFG0596 Protein 2e-29 41
BJ6T_11260 YP_005606006.1 phosphate regulon, two-component response regulator VFG1389 Protein 5e-30 41