Gene Information

Name : Ththe16_1521 (Ththe16_1521)
Accession : YP_005641047.1
Strain : Thermus thermophilus SG0.5JP17-16
Genome accession: NC_017272
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1462105 - 1462788 bp
Length : 684 bp
Strand : +
Note : KEGG: response regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGGGAGGCATGGAGCCGCCCCTGATCCTCATCGTGGAGGACGAGAAGGACATCGCCCGCTTCATTGAGCTTGAGCTCCA
GGCCGAGGGCTACCGCACCGAGGTGGCCCACGACGGGATCACCGGGCTTTCCAAGTTCCGGGAGGTGAGCCCCAACCTGG
TGATCCTGGACCTGATGCTCCCCGTGATGGACGGGATTGAGGTGGCCAAGCGCATCCGAAAGACCTCCAACGTGCCCATC
CTGATCCTCACCGCCAAGGACCGCGTGGAGGACAAGGTGGAGGGGCTGGACGCGGGGGCCGACGACTACCTGGTGAAGCC
CTTCTCCATAGAAGAGCTCCTCGCCCGGGTGCGGGCCCACCTCCGCCGGGTCACCCCGGCCATCACCGGGGAGATCCGGG
TGGCGGACCTCATCATCAACCTCGAGGGCCGGGAGGTCTTCCGGGGAAACCGCCGCATTGAACTCTCCAACAAGGAGTTT
GAGCTTCTGGAGCTCCTCGCCAAAAACCCCGGCAAGGTCTTCAGCCGCTACGAGATTGAGGAGAAGGTCTGGCCCGGCTA
CCAAGGGGGAAGCAACGTGGTGGACGTCTACATCGGCTACCTGCGCAAGAAGCTGGAGGCGGGGGGGGAGCGCCGCCTCA
TCCACACGGTGCGGGGCGTGGGGTACGTCCTCAGGGAGGACTGA

Protein sequence :
MGGMEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSKFREVSPNLVILDLMLPVMDGIEVAKRIRKTSNVPI
LILTAKDRVEDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGNRRIELSNKEF
ELLELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-39 50
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 49
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-33 46
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-29 46
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-35 44
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-32 44
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-33 44
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-33 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-31 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-31 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-27 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-30 42
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-28 42
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-34 42
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 3e-21 41
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-31 41
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 3e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-45 51
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-30 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-36 43
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-27 42
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-35 42
Ththe16_1521 YP_005641047.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-26 41