Gene Information

Name : Ththe16_1735 (Ththe16_1735)
Accession : YP_005641257.1
Strain : Thermus thermophilus SG0.5JP17-16
Genome accession: NC_017272
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1645514 - 1645714 bp
Length : 201 bp
Strand : +
Note : PFAM: Heavy metal transport/detoxification protein; KEGG: putative heavy metal-binding protein

DNA sequence :
ATGCTGAAGCTCAAGGTGGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTGACCAAGGCCCTGAAGAAGGTCCCCGG
CGTGGAGAAGGTAGAGGTCTCCCTAGAAAAGGGGGAGGCCCTGGTGGAGGGGACGGCCGACCCCAAGGCCCTCGTCCAGG
CGGTGGAGGAGGAAGGGTACAAGGCCGAGGTTCTGGCCTAA

Protein sequence :
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-09 47
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-08 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-08 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-08 44
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-08 44
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-08 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-07 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_1735 YP_005641257.1 heavy metal transport/detoxification protein BAC0085 Protein 2e-04 42
Ththe16_1735 YP_005641257.1 heavy metal transport/detoxification protein BAC0231 Protein 5e-08 41