Gene Information

Name : Ththe16_1739 (Ththe16_1739)
Accession : YP_005641261.1
Strain : Thermus thermophilus SG0.5JP17-16
Genome accession: NC_017272
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1648631 - 1649308 bp
Length : 678 bp
Strand : +
Note : KEGG: phoP1; alkaline phosphatase synthesis transcriptional regulatory protein PhoP; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver

DNA sequence :
ATGAGGGTTCTCCTGGTGGACGACGACCCAGCCCTCCTCGAGGTCCTGGGGGCCTACCTAAGAGGAGCGGGGTTTGAGGT
TTTGCAGGCCGAGGATGGGGAAAGGGCCCTCGAGCTTTACCCCCGGGCCGATCTCATCATCCTGGACCTCATGCTGCCCA
AGCTGGATGGCTTCCGGGTTCTGGCGGAGGTCCGCCGGGAAAGGCCCGAGCTACCCATCCTCATGCTGACGGCAAGAGGG
GAGGAGGAGGAAAGGGTTAAGGGGCTGGAGCTCGGGGCCGACGACTACGTGGTCAAGCCCTTCAGCCCCAAGGAGGTGGT
GGCCCGGGTCAAGGCCCTCCTCAGGCGGGCTGGCCTCAAGGAAGAGCTCAACTATGGCCCCTTGCGCCTTCTTCCCAAGG
AGCGGCAGGCCTACCTGGAGGGCAAGCCCCTTCCCCTTTCCCAGCTGGAATTTGACCTCCTCCTCACCCTGGCCCAGCAT
CCGGGGATGGTCTTCACCCGGGAAAGGCTCTTGGAAAAGGTATGGGGGCCGGATTTCCCGGGGATAGACCGGGTGGTGGA
CGTGCACATCGCTGCTTTGAGAAAAAAGCTCATGGACGATCCGGAAAACCCCCGGTTCATCGAAACGGTACGGGGGGTGG
GGTACCGCTTCCGGGAAGGCGATGCGCCTCTTCGCTAA

Protein sequence :
MRVLLVDDDPALLEVLGAYLRGAGFEVLQAEDGERALELYPRADLIILDLMLPKLDGFRVLAEVRRERPELPILMLTARG
EEEERVKGLELGADDYVVKPFSPKEVVARVKALLRRAGLKEELNYGPLRLLPKERQAYLEGKPLPLSQLEFDLLLTLAQH
PGMVFTRERLLEKVWGPDFPGIDRVVDVHIAALRKKLMDDPENPRFIETVRGVGYRFREGDAPLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-35 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-34 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-44 49
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-48 47
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-35 47
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-42 46
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-34 45
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-31 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-39 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-36 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-35 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-35 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-35 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 6e-36 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator BAC0596 Protein 6e-36 44
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-37 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 6e-38 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-37 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 6e-28 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-31 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-30 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 6e-31 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-31 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-30 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-34 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 1e-35 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 9e-35 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 9e-35 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 8e-37 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-38 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-33 47
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-35 43
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-29 41
Ththe16_1739 YP_005641261.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-35 41