Gene Information

Name : TCCBUS3UF1_19440 (TCCBUS3UF1_19440)
Accession : YP_005655056.1
Strain : Thermus sp. CCB_US3_UF1
Genome accession: NC_017278
Putative virulence/resistance : Resistance
Product : heavy metal transport/detoxification protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1954573 - 1954773 bp
Length : 201 bp
Strand : +
Note : similar to putative mercuric reductase PRK13748; similar to Heavy metal transport/detoxification protein of Truepera radiovictrix DSM 17093 UniRef RepID=D7CSQ2_9DEIN

DNA sequence :
ATGGTGAGGCTCAAGGTGGAAGGGATGACCTGCAACCACTGCGCGATGGCGGTGAAGAAGGCCCTCTTGCGCACCCCCGG
GGTGGAGCGGGCCGAGGTGAGCCTGGAAAGGGGCGAGGCCGTGGTGGAGGGGAAGGCGGACCCCATGGCCCTGGTCCGGG
CGGTGGAGGAGGAAGGCTACCGGGCCTCCCTGGCGGGGTAG

Protein sequence :
MVRLKVEGMTCNHCAMAVKKALLRTPGVERAEVSLERGEAVVEGKADPMALVRAVEEEGYRASLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-10 45
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-08 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-08 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-08 43
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-08 43
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-08 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-08 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-09 41
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TCCBUS3UF1_19440 YP_005655056.1 heavy metal transport/detoxification protein BAC0231 Protein 9e-09 41