Gene Information

Name : marA (ETAF_2098)
Accession : YP_005699696.1
Strain : Edwardsiella tarda FL6-60
Genome accession: NC_017309
Putative virulence/resistance : Resistance
Product : Multiple antibiotic resistance protein MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2394068 - 2394421 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
ATGTACAATACCGATTTTATCAGCGCACTGCGCACCTGGATCGACAGCAACGTTGCCGCTATCTCATCCCTTGACGACGT
GGCGGCACGCGCCGGTTACTCCAAATGGCACCTGCAGCGCATGTTTAAAGCGCACACCGGCGTTCGGCTGGGGGAGTATA
TCCGCAATAAAAAGCTGGATGAATCGGCCCGTCGGCTAAAAGTCTGCCAGGGTTCGATTCTCGACATCGCCCTGTCGATG
GGCTTTGACTCCCAACGCTCCTTTACCCGCTCTTTCAAGCGGCGCTTTGACGTGACGCCGGGCGTATGGAAGAAAGAGGT
GACGGCGGGAAAACCGCTGGATCGCGCCGCCTGA

Protein sequence :
MYNTDFISALRTWIDSNVAAISSLDDVAARAGYSKWHLQRMFKAHTGVRLGEYIRNKKLDESARRLKVCQGSILDIALSM
GFDSQRSFTRSFKRRFDVTPGVWKKEVTAGKPLDRAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-19 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-19 46
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-18 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP000647.1.gene1624. Protein 1e-21 52
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP001138.1.gene1637. Protein 4e-21 50
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP000034.1.gene1596. Protein 3e-21 50
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP001918.1.gene2033. Protein 3e-21 47
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP001138.1.gene612.p Protein 2e-20 46
marA YP_005699696.1 Multiple antibiotic resistance protein MarA BAC0560 Protein 4e-21 46
marA YP_005699696.1 Multiple antibiotic resistance protein MarA NC_002695.1.917339.p Protein 4e-21 46
marA YP_005699696.1 Multiple antibiotic resistance protein MarA NC_010558.1.6276025. Protein 9e-20 46
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP001138.1.gene4488. Protein 5e-19 44
marA YP_005699696.1 Multiple antibiotic resistance protein MarA NC_002695.1.914293.p Protein 4e-19 43
marA YP_005699696.1 Multiple antibiotic resistance protein MarA BAC0371 Protein 4e-19 43
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP000647.1.gene4499. Protein 5e-20 42
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP000034.1.gene4505. Protein 1e-18 42
marA YP_005699696.1 Multiple antibiotic resistance protein MarA CP001918.1.gene327.p Protein 2e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_005699696.1 Multiple antibiotic resistance protein MarA VFG1038 Protein 8e-20 46
marA YP_005699696.1 Multiple antibiotic resistance protein MarA VFG0585 Protein 5e-19 44