Gene Information

Name : OG1RF_10965 (OG1RF_10965)
Accession : YP_005708022.1
Strain : Enterococcus faecalis OG1RF
Genome accession: NC_017316
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1005355 - 1006059 bp
Length : 705 bp
Strand : +
Note : COG: COG0745; Pfam: PF00072,PF00486; InterPro: IPR001789

DNA sequence :
GTGAAGAAAATTTTAGTAGTTGATGACGAGAAGCCAATTTCAGAGATCGTTAAATATAATTTGGTTAAAGAAGGATATGA
AGTATTTACTGCTTATGATGGAGAAGAAGCACTTGAAAAAGTGGAAGAAGTGGAACCAGACTTAATTATTTTAGACTTAA
TGCTCCCTAAAATGGATGGCTTAGAAGTCGCGCGAGAAGTGCGCAAAACACATGATATGCCAATCATTATGGTGACTGCC
AAAGATTCTGAAATTGATAAGGTTTTAGGATTAGAATTAGGAGCCGATGACTATGTAACGAAACCATTTTCAAATCGTGA
ATTAGTTGCTCGTGTAAAAGCCAATTTACGGCGAGGTGCAACCAATGCGAAAGAAGCCGAGGTGACAACACAATCTGAAT
TAACGATTGGTGATTTAACCATTCATCCTGATGCATACATGGTCTCAAAACGGGGTGAAAAAATTGAATTAACCCACCGT
GAATTTGAGTTACTTTATTACTTAGCAAAACATATCGGACAAGTGATGACTCGTGAACATTTGTTACAAACCGTTTGGGG
TTATGATTATTTTGGTGATGTGCGGACAGTGGACGTAACTGTACGTCGTTTAAGAGAAAAAATTGAAGATAGTCCAAGTC
ATCCAACGTATTTAGTTACTCGTCGTGGGGTTGGTTATTATCTAAGAAATCCTGAACAGGAGTAA

Protein sequence :
MKKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVEEVEPDLIILDLMLPKMDGLEVAREVRKTHDMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRGATNAKEAEVTTQSELTIGDLTIHPDAYMVSKRGEKIELTHR
EFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OG1RF_10965 YP_005708022.1 response regulator NC_012469.1.7685629. Protein 1e-67 71
OG1RF_10965 YP_005708022.1 response regulator NC_009782.5559369.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_002951.3237708.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_007622.3794472.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_002758.1121668.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_009641.5332272.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_013450.8614421.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_007793.3914279.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_002952.2859905.p0 Protein 4e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_003923.1003749.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator NC_002745.1124361.p0 Protein 2e-49 56
OG1RF_10965 YP_005708022.1 response regulator HE999704.1.gene2815. Protein 6e-47 53
OG1RF_10965 YP_005708022.1 response regulator AE016830.1.gene1681. Protein 6e-45 49
OG1RF_10965 YP_005708022.1 response regulator NC_012469.1.7686381. Protein 7e-40 48
OG1RF_10965 YP_005708022.1 response regulator AE000516.2.gene3505. Protein 2e-33 48
OG1RF_10965 YP_005708022.1 response regulator CP004022.1.gene3215. Protein 9e-35 47
OG1RF_10965 YP_005708022.1 response regulator AF155139.2.orf0.gene Protein 5e-37 46
OG1RF_10965 YP_005708022.1 response regulator FJ349556.1.orf0.gene Protein 3e-37 46
OG1RF_10965 YP_005708022.1 response regulator CP001138.1.gene4273. Protein 8e-34 46
OG1RF_10965 YP_005708022.1 response regulator BAC0533 Protein 5e-34 46
OG1RF_10965 YP_005708022.1 response regulator NC_002695.1.915041.p Protein 2e-33 46
OG1RF_10965 YP_005708022.1 response regulator CP000647.1.gene4257. Protein 5e-34 46
OG1RF_10965 YP_005708022.1 response regulator CP000034.1.gene3834. Protein 2e-33 46
OG1RF_10965 YP_005708022.1 response regulator NC_002951.3238224.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_007793.3914065.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_002758.1121390.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_010079.5776364.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_002952.2859858.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_007622.3794948.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_003923.1003417.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator NC_013450.8614146.p0 Protein 2e-34 44
OG1RF_10965 YP_005708022.1 response regulator CP000034.1.gene2186. Protein 4e-28 44
OG1RF_10965 YP_005708022.1 response regulator NC_002695.1.916589.p Protein 3e-28 44
OG1RF_10965 YP_005708022.1 response regulator BAC0039 Protein 4e-28 44
OG1RF_10965 YP_005708022.1 response regulator HE999704.1.gene1528. Protein 5e-30 43
OG1RF_10965 YP_005708022.1 response regulator AF130997.1.orf0.gene Protein 1e-32 43
OG1RF_10965 YP_005708022.1 response regulator AM180355.1.gene1830. Protein 2e-35 43
OG1RF_10965 YP_005708022.1 response regulator AE015929.1.gene1106. Protein 3e-29 43
OG1RF_10965 YP_005708022.1 response regulator NC_010410.6002989.p0 Protein 6e-28 43
OG1RF_10965 YP_005708022.1 response regulator NC_010400.5986590.p0 Protein 2e-27 43
OG1RF_10965 YP_005708022.1 response regulator NC_011595.7057856.p0 Protein 6e-28 43
OG1RF_10965 YP_005708022.1 response regulator BAC0596 Protein 8e-27 43
OG1RF_10965 YP_005708022.1 response regulator CP001138.1.gene2239. Protein 8e-27 43
OG1RF_10965 YP_005708022.1 response regulator NC_005054.2598277.p0 Protein 6e-35 42
OG1RF_10965 YP_005708022.1 response regulator NC_014475.1.orf0.gen Protein 6e-35 42
OG1RF_10965 YP_005708022.1 response regulator AF162694.1.orf4.gene Protein 2e-32 42
OG1RF_10965 YP_005708022.1 response regulator CP000647.1.gene2531. Protein 3e-27 42
OG1RF_10965 YP_005708022.1 response regulator CP001918.1.gene3444. Protein 4e-27 42
OG1RF_10965 YP_005708022.1 response regulator BAC0308 Protein 2e-24 41
OG1RF_10965 YP_005708022.1 response regulator BAC0197 Protein 2e-25 41
OG1RF_10965 YP_005708022.1 response regulator EU250284.1.orf4.gene Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OG1RF_10965 YP_005708022.1 response regulator VFG1386 Protein 9e-32 44
OG1RF_10965 YP_005708022.1 response regulator VFG1389 Protein 4e-28 44
OG1RF_10965 YP_005708022.1 response regulator VFG0596 Protein 4e-28 41
OG1RF_10965 YP_005708022.1 response regulator VFG1702 Protein 2e-33 41