Gene Information

Name : SinmeB_0135 (SinmeB_0135)
Accession : YP_005712324.1
Strain : Sinorhizobium meliloti BL225C
Genome accession: NC_017322
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator PhoB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 152492 - 153175 bp
Length : 684 bp
Strand : +
Note : TIGRFAM: Signal transduction response regulator, phosphate regulon transcriptional regulatory protein PhoB; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; KEGG: smd:Smed_0124 two componen

DNA sequence :
ATGTTGCCGAAGATTGCCGTAGTCGAAGATGAGGAAGCCCTAAGCGTTCTCCTGCGCTACAATCTCGAGGCAGAAGGCTT
CGAGGTCGATACGATCCTTCGCGGCGACGAGGCGGAGATCCGCCTGCAGGAGCGCCTGCCCGACCTTCTCATCCTCGATT
GGATGCTGCCCGGGGTTTCCGGCATCGAGCTCTGCCGCAGGCTGCGCCAGCGGCCGGAAACGGAGCGCCTGCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAGAGCGAGCGCGTGCGGGGCCTTGCCACCGGGGCCGACGATTACGTCGTCAAGCCCTT
CTCGACGCCGGAACTGATGGCGAGGGTCAAGGCTATGCTCAGGCGCGCCAAGCCCGAGGTTCTGTCGACGCTCCTGCGCT
GCGGCGATATCGAGCTCGACCGGGAGACGCACCGCGTCCACCGCCGCAGCCGTGAAGTGCGCCTCGGCCCGACGGAGTTC
CGGCTGCTGGAATTTCTCATGTCCTCACCGGGGCGCGTCTTCTCCCGTTCACAGCTCCTGGACGGTGTCTGGGGGCACGA
CATCTATGTCGACGAACGGACCGTGGACGTCCATGTCGGACGTCTGCGCAAGGCACTGAACTTCTCCAACATGCCCGACG
TCATCCGGACGGTGCGCGGCGCGGGCTATTCGCTGGAGAGCTGA

Protein sequence :
MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVSGIELCRRLRQRPETERLPII
MLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAMLRRAKPEVLSTLLRCGDIELDRETHRVHRRSREVRLGPTEF
RLLEFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAGYSLES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 43
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 6e-27 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB HE999704.1.gene2815. Protein 4e-40 44
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB AE000516.2.gene3505. Protein 9e-34 44
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002952.2859905.p0 Protein 1e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002758.1121668.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_009641.5332272.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_013450.8614421.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_007793.3914279.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_003923.1003749.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_007622.3794472.p0 Protein 1e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002745.1124361.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_009782.5559369.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002951.3237708.p0 Protein 2e-41 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB CP001918.1.gene3444. Protein 1e-32 42
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_010410.6002989.p0 Protein 1e-35 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_010400.5986590.p0 Protein 1e-34 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_011595.7057856.p0 Protein 1e-35 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_012469.1.7685629. Protein 4e-36 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002516.2.879194.p Protein 8e-27 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB CP000034.1.gene2186. Protein 6e-32 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB NC_002695.1.916589.p Protein 5e-32 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB CP000647.1.gene2531. Protein 7e-33 41
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB BAC0039 Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB VFG1390 Protein 3e-36 45
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB VFG1563 Protein 5e-35 43
SinmeB_0135 YP_005712324.1 winged helix family two component transcriptional regulator PhoB VFG1702 Protein 5e-35 43