Gene Information

Name : cusR (SFxv_0519)
Accession : YP_005726142.1
Strain : Shigella flexneri 2002017
Genome accession: NC_017328
Putative virulence/resistance : Virulence
Product : putative 2-component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 506518 - 507201 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAACTGTTGATTGTCGAAGATGAAAAGAAAACCGGAGAATACTTGACCAAAGGGTTAACCGAAGCCGGTTTTGTGGT
CGATTTGGCCGACAACGGGCTGAATGGCTACCATCTGGCGATGACCGGTGATTATGACCTGATAATCCTCGATATTATGC
TGCCAGACGTGAACGGCTGGGATATCGTGCGCATGTTGCGCTCCGCCAATAAAGGGATGCCGATTCTGTTGCTTACCGCG
CTTGGCACCATTGAACATCGCGTCAAGGGGCTGGAGTTGGGGGCAGATGACTACCTGGTGAAACCGTTCGCTTTTGCTGA
ACTGCTGGCGCGGGTGCGCACTCTCCTGCGGCGCGGGGCGGCGGTGATTATCGAAAGTCAGTTTCAGGTTGCCGATCTGA
TGGTCGATCTCGTCAGCCGCAAAGTCACCCGCAGCGGCACGCGCATCACTCTGACCAGTAAAGAATTTACTCTGCTGGAG
TTTTTTCTCCGCCATCAGGGCGAAGTGCTGCCCCGCTCGCTTATCGCCTCGCAGGTATGGGACATGAATTTCGACAGCGA
CACTAACGCCATTGATGTGGCGGTGAAGCTGCTACGCGGCAAAATCGACAACGACTTTGAGCCGAAGCTGATTCAAACCG
TGCGCGGCGTGGGTTACATGCTTGAGGTGCCGGATGGTCAGTAA

Protein sequence :
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLE
FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKLLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-55 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-55 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0111 Protein 7e-103 99
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0347 Protein 3e-86 82
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0083 Protein 1e-69 61
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0638 Protein 2e-62 61
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0308 Protein 8e-63 60
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0197 Protein 7e-63 59
cusR YP_005726142.1 putative 2-component transcriptional regulator BAC0125 Protein 6e-63 56
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_002951.3238224.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_007793.3914065.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_002758.1121390.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_010079.5776364.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_002952.2859858.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_007622.3794948.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_003923.1003417.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator NC_013450.8614146.p0 Protein 9e-35 41
cusR YP_005726142.1 putative 2-component transcriptional regulator AE000516.2.gene3505. Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005726142.1 putative 2-component transcriptional regulator VFG0596 Protein 1e-55 52
cusR YP_005726142.1 putative 2-component transcriptional regulator VFG1390 Protein 8e-44 43
cusR YP_005726142.1 putative 2-component transcriptional regulator VFG1389 Protein 2e-34 41