
|
Name : SATW20_00540 (SATW20_00540) Accession : YP_005730078.1 Strain : Staphylococcus aureus TW20 Genome accession: NC_017331 Putative virulence/resistance : Unknown Product : IS431 transposase Function : - COG functional category : - COG ID : - EC number : - Position : 58612 - 59286 bp Length : 675 bp Strand : - Note : - DNA sequence : ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATGCATTGAG TTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAAT ATGCACCAATTTTATATCGAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATC AAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCA ACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATC AGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAA TATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAA GAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGC CATGCCACGAAATTAGCATCATGCTAGCAAGTTAA Protein sequence : MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYRIWKKKHKKAYYKWRIDETYI KIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSK YLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | BAB47638.1 | putative transposase of IS431 | Not tested | Type-III SCCmec | Protein | 2e-96 | 100 |
| unnamed | BAB47648.1 | putative transposase of IS431 | Not tested | Type-III SCCmec | Protein | 2e-96 | 100 |
| SAPIG0054 | YP_005732864.1 | transposase | Not tested | Type-V SCCmec | Protein | 2e-96 | 100 |
| SE0090 | NP_763645.1 | transposase for IS-like element | Not tested | SCCpbp4 | Protein | 2e-96 | 100 |
| SA0026 | NP_373265.1 | transposase for IS-like element | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| tnp | YP_252008.1 | transposase for IS431mec | Not tested | SCCmec | Protein | 1e-95 | 99 |
| tnp | BAC67570.1 | transposase of IS431mec | Not tested | Type-IVc SCCmec | Protein | 5e-96 | 99 |
| unnamed | ACL99852.1 | transposase | Not tested | Type-V SCCmec | Protein | 4e-95 | 99 |
| SA0034 | NP_373274.1 | transposase for IS-like element | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| SACOL0028 | YP_184939.1 | IS431mec, transposase | Not tested | Type-I SCCmec | Protein | 7e-96 | 99 |
| unnamed | BAA82228.1 | transposase for insertion sequence-like element IS431mec | Not tested | Type-II SCCmec | Protein | 5e-96 | 99 |
| tnp | BAG06195.1 | transposase for IS431 | Not tested | Type-VII SCCmec | Protein | 4e-95 | 99 |
| SAUSA300_0028 | YP_492748.1 | putative transposase | Not tested | Type-IV SCCmec | Protein | 7e-96 | 99 |
| SAR0027 | YP_039504.1 | transposase | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| unnamed | BAA82238.1 | transposase for insertion sequence-like element IS431mec | Not tested | Type-II SCCmec | Protein | 5e-96 | 99 |
| unnamed | BAB47635.1 | putative transposase of IS431 | Not tested | Type-III SCCmec | Protein | 3e-95 | 99 |
| SERP2526 | YP_190067.1 | IS431mec-like transposase | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| SAR0034 | YP_039511.1 | transposase | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| tnp | BAD24823.1 | transposase for IS431 | Not tested | Type-V SCCmec | Protein | 2e-95 | 99 |
| tnp | YP_252002.1 | transposase for IS431mec | Not tested | SCCmec | Protein | 7e-96 | 99 |
| SAMSHR1132_00280 | YP_005324552.1 | putative transposase | Not tested | Type-IIIinv SCCmec | Protein | 7e-96 | 99 |
| tnp | YP_252034.1 | transposase for IS431mec | Not tested | SCCmec | Protein | 8e-95 | 99 |
| tnp | BAA86652.1 | transposase | Not tested | Type-I SCCmec | Protein | 5e-96 | 99 |
| SE0071 | NP_763626.1 | transposase for IS-like element | Not tested | SCCpbp4 | Protein | 6e-96 | 99 |
| MW0027 | NP_644842.1 | transposase for IS-like element | Not tested | Type-IV SCCmec | Protein | 7e-96 | 99 |
| SAPIG0038 | YP_005732848.1 | transposase | Not tested | Type-V SCCmec | Protein | 5e-95 | 99 |
| unnamed | BAB47631.1 | putative transposase of IS431 | Not tested | Type-III SCCmec | Protein | 5e-96 | 99 |
| tnp | NP_370551.1 | transposase for IS-like element | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| SERP1579 | YP_189144.1 | IS431mec-like transposase | Not tested | ¥ÕSP¥â | Protein | 2e-95 | 99 |
| tnp | BAB72117.1 | transposase of IS431mec | Not tested | Type-IVa SCCmec | Protein | 5e-96 | 99 |
| tnp | NP_370560.2 | transposase for IS-like element | Not tested | Type-II SCCmec | Protein | 7e-96 | 99 |
| SE0079 | NP_763634.1 | transposase for IS-like element | Not tested | SCCpbp4 | Protein | 1e-95 | 99 |
| tnp | BAB72136.1 | transposase of IS431mec | Not tested | Type-IVb SCCmec | Protein | 5e-96 | 99 |
| unnamed | BAD24828.1 | transposase for IS431 | Not tested | Type-V SCCmec | Protein | 7e-95 | 98 |
| tnp | YP_251940.1 | transposase for IS431mec | Not tested | SCCmec | Protein | 6e-94 | 97 |
| unnamed | AAP55235.1 | transposase | Not tested | SaPIbov2 | Protein | 4e-94 | 97 |
| tnp | YP_254240.1 | transposase for IS431mec | Not tested | ¥ðSh1 | Protein | 2e-91 | 96 |
| ef0041 | AAM75240.1 | EF0034 | Not tested | Not named | Protein | 7e-57 | 60 |
| ef0039 | AAM75245.1 | EF0039 | Not tested | Not named | Protein | 6e-48 | 55 |
| tnpA6100 | ACN81001.1 | transposase | Not tested | AbaR5 | Protein | 3e-28 | 43 |
| tnpA6100 | ACN62081.1 | TnpA6100 | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnp6100 | ACS32049.1 | Tnp6100 | Not tested | SGI2 | Protein | 2e-28 | 43 |
| tnp6100 | ACX47960.1 | tnp6100 | Not tested | SGI1 | Protein | 4e-29 | 43 |
| tnpA6100 | AGF34993.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| CDBH8_0916 | YP_005160008.1 | transposase-like protein | Not tested | Not named | Protein | 3e-28 | 43 |
| tnpA6100 | AGK07018.1 | IS6100 transposase | Not tested | SGI1 | Protein | 4e-29 | 43 |
| tnpA6100 | AGF35032.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA6100 | AGK07076.1 | IS6100 transposase | Not tested | SGI1 | Protein | 4e-29 | 43 |
| tnpA6100 | AGF35067.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA6100 | AGK06937.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA6100 | AGK06983.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA6100 | AGK07042.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA6100 | AGK07113.1 | IS6100 transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA | AAG03007.1 | transposase | Not tested | SGI1 | Protein | 2e-28 | 43 |
| tnpA | CAJ77056.1 | Transposase | Not tested | AbaR1 | Protein | 2e-28 | 43 |
| tpnIS26 | ADZ05778.1 | transposase | Not tested | AbaR12 | Protein | 2e-25 | 41 |
| tpnIS26 | ADZ05794.1 | transposase | Not tested | AbaR16 | Protein | 2e-25 | 41 |
| tnpA26 | AGK07095.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tpnIS26 | ADZ05788.1 | transposase | Not tested | AbaR15 | Protein | 1e-25 | 41 |
| tnp26 | AGK36639.1 | transposase of IS26 | Not tested | AbaR26 | Protein | 2e-25 | 41 |
| tnpA26 | ACV89829.1 | transposase of IS26 | Not tested | AbaR6 | Protein | 2e-25 | 41 |
| tnpA26 | AGK07097.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tpnIS26 | ADZ05800.1 | transposase | Not tested | AbaR19 | Protein | 1e-25 | 41 |
| tnpA26 | ACV89831.1 | transposase of IS26 | Not tested | AbaR7 | Protein | 2e-25 | 41 |
| tnpA26 | AFV53107.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 1e-25 | 41 |
| tnpA | AET25383.1 | TnpA | Not tested | PAGI-2(C) | Protein | 1e-25 | 41 |
| tnpA26 | ADK35781.1 | transposase of IS26 | Not tested | AbaR8 | Protein | 2e-25 | 41 |
| tnpA26 | AFV53108.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 1e-25 | 41 |
| tnpA | AFG30106.1 | TnpA | Not tested | PAGI-2 | Protein | 1e-25 | 41 |
| tpnIS26 | ADZ05796.1 | transposase | Not tested | AbaR17 | Protein | 2e-25 | 41 |
| tnpA26 | AFV53110.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 1e-25 | 41 |
| tnpA26 | AGK07034.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tpnIS26 | ADZ05798.1 | transposase | Not tested | AbaR18 | Protein | 2e-25 | 41 |
| tnpA26 | AFV53122.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 1e-25 | 41 |
| tnpA26 | AGK07037.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tpnIS26 | ADZ05810.1 | transposase | Not tested | AbaR20 | Protein | 2e-25 | 41 |
| Pmu_03450 | YP_005176243.1 | IS26 transposase | Not tested | ICEPmu1 | Protein | 2e-25 | 41 |
| Pmu_03480 | YP_005176246.1 | IS26 transposase | Not tested | ICEPmu1 | Protein | 3e-25 | 41 |
| tnpA26 | AGK07039.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tnpA26 | ACK44541.1 | TnpA | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tnpA26 | AFV53109.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 2e-25 | 41 |
| tnpA26 | ACN81018.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 2e-25 | 41 |
| tnpA26 | ACN81016.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 3e-25 | 41 |
| tnpA26 | AGK07092.1 | IS26 transposase | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tnpA26 | ACK44543.1 | TnpA | Not tested | SGI1 | Protein | 1e-25 | 41 |
| tnp26 | AGK36641.1 | transposase of IS26 | Not tested | AbaR26 | Protein | 2e-25 | 41 |
| tnpA26 | ACN81013.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 2e-25 | 41 |
| ABTW07_3875 | YP_005797123.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 3e-25 | 41 |
| ABTW07_3890 | YP_005797138.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 3e-25 | 41 |
| IS26 | CAJ77078.1 | Insertion sequence | Not tested | AbaR1 | Protein | 2e-25 | 41 |
| ABTW07_3906 | YP_005797154.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 3e-25 | 41 |
| tnp7109-28 | YP_001800928.1 | transposase for insertion sequence | Not tested | Not named | Protein | 2e-25 | 41 |
| unnamed | AEZ06025.1 | TnpA26, Transposase of IS26 | Not tested | AbaR24 | Protein | 2e-25 | 41 |
| tnp7109-29 | YP_001800930.1 | transposase for insertion sequence | Not tested | Not named | Protein | 2e-25 | 41 |
| ABTW07_3872 | YP_005797120.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 3e-25 | 41 |
| IS26 | CAJ77074.1 | Insertion sequence | Not tested | AbaR1 | Protein | 2e-25 | 41 |