Gene Information

Name : SAOV_1425c (SAOV_1425c)
Accession : YP_005736914.1
Strain : Staphylococcus aureus ED133
Genome accession: NC_017337
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1468870 - 1469529 bp
Length : 660 bp
Strand : -
Note : -

DNA sequence :
ATGACGCAAATTTTAATAGTAGAAGATGAACAAAACTTAGCAAGATTTCTTGAATTGGAACTCACACATGAAAATTACAA
TGTGGACACAGAGTATGATGGACAAGACGGTTTAGATAAAGCGCTTAGCCATTACTATGATTTAATCATATTAGATTTAA
TGTTGCCGTCAATTAATGGCTTAGAAATTTGTCGCAAAATTAGACAACAACAATCTACACCTATCATTATAATTACAGCG
AAAAGTGATACGTATGACAAAGTTGCTGGGCTTGATTACGGTGCAGACGATTATATAGTTAAACCATTTGATATTGAAGA
ACTTTTAGCAAGAATTCGTGCGATTTTACGTCGTCAGCCACAAAAAGATATCATCGATGTCAACGGTATTACAATTGATA
AGAATGCTTTTAAAGTGACGGTAAATGGCGCAGAAATTGAATTAACAAAAACAGAGTATGATTTACTATATCTTCTAGCT
GAAAATAAAAATCATGTTATGCAACGGGAACAAATTTTAAATCATGTATGGGGTTATAATAGTGAAGTAGAAACAAATGT
CGTAGATGTTTATATAAGATATTTACGAAACAAGTTAAAACCATACGATCGTGATAAAATGATTGAAACAGTTCGTGGCG
TTGGGTATGTGATACGATGA

Protein sequence :
MTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEICRKIRQQQSTPIIIITA
KSDTYDKVAGLDYGADDYIVKPFDIEELLARIRAILRRQPQKDIIDVNGITIDKNAFKVTVNGAEIELTKTEYDLLYLLA
ENKNHVMQREQILNHVWGYNSEVETNVVDVYIRYLRNKLKPYDRDKMIETVRGVGYVIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-33 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAOV_1425c YP_005736914.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-90 100
SAOV_1425c YP_005736914.1 two-component response regulator AE015929.1.gene1106. Protein 3e-74 85
SAOV_1425c YP_005736914.1 two-component response regulator HE999704.1.gene1528. Protein 3e-48 53
SAOV_1425c YP_005736914.1 two-component response regulator BAC0125 Protein 7e-33 44
SAOV_1425c YP_005736914.1 two-component response regulator BAC0197 Protein 3e-31 43
SAOV_1425c YP_005736914.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-31 42
SAOV_1425c YP_005736914.1 two-component response regulator NC_014475.1.orf0.gen Protein 4e-28 41
SAOV_1425c YP_005736914.1 two-component response regulator NC_005054.2598277.p0 Protein 4e-28 41
SAOV_1425c YP_005736914.1 two-component response regulator BAC0308 Protein 1e-30 41
SAOV_1425c YP_005736914.1 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-28 41
SAOV_1425c YP_005736914.1 two-component response regulator BAC0111 Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAOV_1425c YP_005736914.1 two-component response regulator VFG0596 Protein 8e-34 45
SAOV_1425c YP_005736914.1 two-component response regulator VFG1563 Protein 3e-26 41