Gene Information

Name : SAA6008_02627 (SAA6008_02627)
Accession : YP_005745938.1
Strain : Staphylococcus aureus JKD6008
Genome accession: NC_017341
Putative virulence/resistance : Resistance
Product : transcriptional repressor
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2759207 - 2759587 bp
Length : 381 bp
Strand : -
Note : PFAM: Penicillinase repressor KEGG: sau:SAP012 penicillinase repressor

DNA sequence :
ATGGCCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGGGGTAAAAAATCAGTATCAGC
TAATGAAATTGTAGTTGAAATTCAAAAATATAAAGAAGTTAGCGATAAAACGATTAGAACATTAATCACAAGACTATATA
AAAAAGAGATTATAAAACGATACAAATCAGAGAATATTTATTTTTACTCATCAAATATTAAAGAAGACGATATTAAAATG
AAAACTGCTAAAACCTTTCTTAATAAACTGTATGGAGGGGACATGAAAAGTTTAGTGCTGAATTTTGCGAAAAATGAAGA
ATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTAAATGATATTAGTAAAAAGTAA

Protein sequence :
MANKQVEISMAEWDVMNIIWGKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKM
KTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaI YP_253677.1 beta-lactamase repressor Not tested ¥ÕSh1 Protein 3e-44 100
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 2e-20 62
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 2e-20 62
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 2e-20 62
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-20 62
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 9e-20 61
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 4e-20 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_002952.2858973.p0 Protein 1e-44 100
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_005054.2598289.p0 Protein 1e-44 100
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_010419.6155809.p0 Protein 4e-44 99
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_010066.5774788.p0 Protein 3e-44 99
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_003140.1122763.p0 Protein 4e-44 99
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_005011.2598314.p0 Protein 3e-44 99
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_005951.2853407.p0 Protein 3e-44 99
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_002745.1122814.p0 Protein 7e-21 62
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_002952.2861158.p0 Protein 1e-20 62
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_009782.5560220.p0 Protein 3e-20 61
SAA6008_02627 YP_005745938.1 transcriptional repressor NC_002758.1120003.p0 Protein 3e-20 61
SAA6008_02627 YP_005745938.1 transcriptional repressor FR823292.1.gene6.p01 Protein 1e-20 52