Gene Information

Name : SARLGA251_00330 (SARLGA251_00330)
Accession : YP_005754048.1
Strain : Staphylococcus aureus LGA251
Genome accession: NC_017349
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 42487 - 42993 bp
Length : 507 bp
Strand : -
Note : Similar to Staphylococcus aureus (strain MRSA252) subname: full=putative uncharacterized protein UniProt:Q6GKP5 (EMBL:BX571856) (168 aa) fasta scores: E()=9.4e-45, 67.9% id in 168 aa

DNA sequence :
ATGCAGAATATACGATGTATTTTACAAACTGAAGCCATATTCAGTGATGACCAACAACATCGATACTTGCTTAATAAAAC
ATGGGACAGTAAGAAGCAAACGATCACAATCATCACAATGTATCCACATTATAATGGCATTCTCAATATAGATTTAACAA
CCCAACTCATAATAAACAAAGTTTCAGAAATGGAAGCATTTGGTTCCATCAATTTTGTGAATCTATACTCTAATATTACA
ACCCCTATCAATCTCAAACATTTAGAAAATGCCTATGATAAGCATACGGATATTCAAATTATGAAGGCAGTAAAAGAATC
AGATGAAGTGATATTAGCTTGGGGTGCTTACGCTAAAAAACCCGTTGTCGAAGCACGCGTTAATGAAGTTATGGAGATGT
TGAAACCACATAAGAAGAAAGTGAAACAACTTATGAATCCAGCAACCAATGAAATCATGCATCCCCTTAATCCAAAAGCA
AGACAAAAATGGACTTTGAAAGCATAA

Protein sequence :
MQNIRCILQTEAIFSDDQQHRYLLNKTWDSKKQTITIITMYPHYNGILNIDLTTQLIINKVSEMEAFGSINFVNLYSNIT
TPINLKHLENAYDKHTDIQIMKAVKESDEVILAWGAYAKKPVVEARVNEVMEMLKPHKKKVKQLMNPATNEIMHPLNPKA
RQKWTLKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 1e-75 100
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-69 89
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-69 88
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 6e-69 88
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-69 88
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-69 88
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 2e-69 88
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 3e-57 84
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 5e-61 77
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 3e-50 69
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 2e-50 69
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 1e-48 68
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 1e-49 68
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-48 68
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-50 68
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-48 68
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-49 68
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-55 68
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-49 68
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-49 68
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 1e-49 68
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 1e-49 68
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 1e-49 68
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 8e-50 68
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 9e-50 68
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-48 68
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-48 68
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-58 68
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-58 68
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 1e-47 67
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-42 65