Gene Information

Name : SARLGA251_00340 (SARLGA251_00340)
Accession : YP_005754049.1
Strain : Staphylococcus aureus LGA251
Genome accession: NC_017349
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 43009 - 43320 bp
Length : 312 bp
Strand : -
Note : Similar to Staphylococcus aureus (strain MRSA252) subname: full=putative uncharacterized protein UniProt:Q6GKP4 (EMBL:BX571856) (103 aa) fasta scores: E()=2.3e-13, 47.2% id in 106 aa

DNA sequence :
ATGAATAAATATATAACACGGGGGATTGCCAATAACTTACCTACCACCTTACAGCATCAATTATGGCAACTTGTAGCACA
ACGTGAAAACGAACAGTCCAAAAAAATAGAAGCAATAGATTACTTTCATATCTTCCAGTTCAATATGCATAATGATCAAT
TATATATCAAACACAAACAAGAACGTCCTAAGTACATTAAAACTCATAAAGCTAATTATTCAAAAGCTATCAATATAAAT
AAGGTCTACATTATCCGAGAAGATGATGAAGACCTTTCTTATTACGTCATGTTACTACCCGAAGAATATTAA

Protein sequence :
MNKYITRGIANNLPTTLQHQLWQLVAQRENEQSKKIEAIDYFHIFQFNMHNDQLYIKHKQERPKYIKTHKANYSKAININ
KVYIIREDDEDLSYYVMLLPEEY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SARLGA251_00340 YP_005754049.1 hypothetical protein Not tested Type-XI SCCmec Protein 3e-43 100
unnamed BAB47670.1 hypothetical protein Not tested Type-III SCCmec Protein 4e-39 90
unnamed BAC53832.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 4e-39 90
SSP0048 YP_300138.1 hypothetical protein Not tested SCC15305cap Protein 1e-38 89
unnamed AAL26664.1 unknown Not tested SCCcap1 Protein 5e-32 86
unnamed BAB47601.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-37 84
unnamed ACL99834.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-37 82
unnamed BAG06193.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-37 82
SAPIG0036 YP_005732846.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-37 82
SSP0032 YP_300122.1 hypothetical protein Not tested SCC15305RM Protein 2e-35 76
unnamed BAB46980.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-17 50
unnamed BAB83490.1 - Not tested SCC 12263 Protein 1e-15 49
SACOL0038 YP_184949.1 hypothetical protein Not tested Type-I SCCmec Protein 5e-16 49
unnamed BAA94330.1 hypothetical protein Not tested Type-I SCCmec Protein 3e-16 49
unnamed BAD24837.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-15 49
unnamed BAB72111.1 hypothetical protein Not tested Type-IVa SCCmec Protein 9e-16 48
SH0058 YP_251973.1 hypothetical protein Not tested SCCmec Protein 3e-15 48
unnamed BAB72130.1 hypothetical protein Not tested Type-IVb SCCmec Protein 9e-16 48
SE0053 NP_763608.1 hypothetical protein Not tested SCCpbp4 Protein 2e-15 48
unnamed BAC67563.1 hypothetical protein Not tested Type-IVc SCCmec Protein 9e-16 48
SAS0030 YP_042163.1 hypothetical protein Not tested SCC476 Protein 2e-15 48
SE0031 NP_763586.1 hypothetical protein Not tested SCCpbp4 Protein 1e-15 48
unnamed BAA94662.1 - Not tested Type-II SCCmec Protein 5e-15 48
SAMSHR1132_00370 YP_005324561.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-15 48
SAR0057 YP_039528.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-15 48
MW0036 NP_644851.1 hypothetical protein Not tested Type-IV SCCmec Protein 1e-15 48
SAV0059 NP_370583.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-15 48
SAPIG0052 YP_005732862.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-16 48
SA0055 NP_373295.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-15 48
SERP2503 YP_190045.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-15 48
unnamed ACL99846.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-16 48
unnamed BAG06214.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-15 48