Gene Information

Name : ABTW07_2689 (ABTW07_2689)
Accession : YP_005799571.1
Strain : Acinetobacter baumannii TCDC-AB0715
Genome accession: NC_017387
Putative virulence/resistance : Resistance
Product : membrane transporter
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2855740 - 2856069 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGTCTTATCTTTATTTAGCAATTGCGATTGCTTGTGAAGTTATTGCAACTTCAGCATTAAAAGCATCTCAAGGTTTTAC
TGTTCCAATTCCGTCTATTATTACGGTTGTGGGTTATGCAGTTGCTTTTTATTTATTATCTCTTACGCTCAAAACAATTC
CGATCGGGATTGCCTATGCCATTTGGTCAGGCGCAGGTATTATTTTAATTTCTGCAATTGGCTGGATATTTTACAAACAG
CATTTAGACTTGGCTGCCTGTATTGGTTTGGCTTTAATGATCGCAGGTATTGTGATTATTAATGTGTTTTCTAAAAACAC
CCATCTATAA

Protein sequence :
MSYLYLAIAIACEVIATSALKASQGFTVPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYAIWSGAGIILISAIGWIFYKQ
HLDLAACIGLALMIAGIVIINVFSKNTHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-14 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-14 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-14 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-14 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-14 54
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-14 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-14 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-14 54
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-14 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-14 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-14 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-14 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-14 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-14 54
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 9e-08 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABTW07_2689 YP_005799571.1 membrane transporter BAC0002 Protein 2e-35 100
ABTW07_2689 YP_005799571.1 membrane transporter NC_010410.6003348.p0 Protein 2e-35 100
ABTW07_2689 YP_005799571.1 membrane transporter BAC0324 Protein 1e-17 55
ABTW07_2689 YP_005799571.1 membrane transporter CP004022.1.gene1549. Protein 5e-14 54
ABTW07_2689 YP_005799571.1 membrane transporter BAC0323 Protein 1e-14 54
ABTW07_2689 YP_005799571.1 membrane transporter BAC0150 Protein 1e-12 53
ABTW07_2689 YP_005799571.1 membrane transporter NC_002695.1.913273.p Protein 1e-12 52
ABTW07_2689 YP_005799571.1 membrane transporter CP001138.1.gene1489. Protein 4e-13 52
ABTW07_2689 YP_005799571.1 membrane transporter BAC0322 Protein 2e-17 51
ABTW07_2689 YP_005799571.1 membrane transporter BAC0377 Protein 4e-17 51
ABTW07_2689 YP_005799571.1 membrane transporter BAC0325 Protein 4e-10 44
ABTW07_2689 YP_005799571.1 membrane transporter BAC0139 Protein 1e-13 44
ABTW07_2689 YP_005799571.1 membrane transporter BAC0140 Protein 4e-09 43
ABTW07_2689 YP_005799571.1 membrane transporter BAC0329 Protein 3e-10 41
ABTW07_2689 YP_005799571.1 membrane transporter BAC0192 Protein 1e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABTW07_2689 YP_005799571.1 membrane transporter VFG1587 Protein 4e-08 45