Gene Information

Name : soxS (EPYR_03535)
Accession : YP_005804286.1
Strain : Erwinia pyrifoliae DSM 12163
Genome accession: NC_017390
Putative virulence/resistance : Resistance
Product : HTH-type transcriptional regulator soxS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3582135 - 3582530 bp
Length : 396 bp
Strand : +
Note : Bacterial regulatory helix-turn-helix proteins,AraC family

DNA sequence :
ATGCATGACGACATCATCAACACCCTGACCAACTGGATCGATAATAATCTGGACAAAGCCCTGTCGATTGATGAAGTGGC
TGCAAAATCGGGCTACTCGAAGTGGCATTTACAGCGTATGTTCCGTACGGTGACAAAACAGACGCTGGGTGGGTATATCC
GGGAACGCCGTTTAACGCTGGCTGCCGAAGCGCTGCGCCAGAGTCAGCGCCCGGTTTTTGACATCGCCATGCAGTACGGC
TACGACTCGCAGCAAACTTTCTCCCGGGTATTTCGTCGTCAGTTTTCCCAGACGCCAACGGCTTATCGTAATACCATGCG
CCGCCAGATGTTGCAGCGTAGCAGCTGGCATTTTGACTGCGGCGACTCCCCAGCCAGCAGCGTTCAATCGCAGTGA

Protein sequence :
MHDDIINTLTNWIDNNLDKALSIDEVAAKSGYSKWHLQRMFRTVTKQTLGGYIRERRLTLAAEALRQSQRPVFDIAMQYG
YDSQQTFSRVFRRQFSQTPTAYRNTMRRQMLQRSSWHFDCGDSPASSVQSQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-33 67
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-23 49
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-23 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP000647.1.gene4499. Protein 3e-34 70
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP001918.1.gene327.p Protein 4e-34 68
soxS YP_005804286.1 HTH-type transcriptional regulator soxS BAC0371 Protein 4e-33 67
soxS YP_005804286.1 HTH-type transcriptional regulator soxS NC_002695.1.914293.p Protein 4e-33 67
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP001138.1.gene4488. Protein 2e-33 67
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP000034.1.gene4505. Protein 9e-33 66
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP001138.1.gene612.p Protein 2e-27 49
soxS YP_005804286.1 HTH-type transcriptional regulator soxS NC_010558.1.6276025. Protein 1e-23 49
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP000647.1.gene1624. Protein 1e-23 48
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP001918.1.gene2033. Protein 2e-23 47
soxS YP_005804286.1 HTH-type transcriptional regulator soxS NC_002695.1.917339.p Protein 3e-23 46
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP001138.1.gene1637. Protein 3e-23 46
soxS YP_005804286.1 HTH-type transcriptional regulator soxS BAC0560 Protein 3e-23 46
soxS YP_005804286.1 HTH-type transcriptional regulator soxS CP000034.1.gene1596. Protein 3e-23 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005804286.1 HTH-type transcriptional regulator soxS VFG0585 Protein 2e-33 67
soxS YP_005804286.1 HTH-type transcriptional regulator soxS VFG1038 Protein 1e-23 49