Gene Information

Name : Hprae_1473 (Hprae_1473)
Accession : YP_005836760.1
Strain : Halanaerobium praevalens DSM 2228
Genome accession: NC_017455
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1626166 - 1626855 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829:IPR001789:IPR001867; KEGG: tte:TTE1016 response regulator; PFAM: response regulator receiver; transcriptional regulator d

DNA sequence :
GTGGATAAAAAAATATTACTGATAGAAGATGATTCTCAAATAGCAAGATTTATAGAATTAGAGCTTGAACATGAAGGTTA
TCAAGTAACAAAATTTGATAATGGTTATGATGGAATAAATATTTTGAAAGAAAAAAGTTTTGATTTATTATTATTAGATA
TTATGTTACCTGGATTAAATGGGATGGAAGTTTGTAGTCAAATAAGAGAGTTTTCTGATATTCCTATAATTATGTTAACT
GCTAAATCTGAATTAGAAGATAAAGTAAAAGGTTTAGATATTGGAGCTGATGATTATTTAACTAAGCCTTTTGAAATTGA
AGAATTATTAGCGAGAATTCGAGCTCATTTAAGAAGAGATGAAGGTAATTTGGAAAATGAAAATATATTAAAAACGGCTG
ATGTTGAAGTTAAATTAGATGCCCATATAGTAAAAAGAGCTGGTGAAGAAATAGAATTAACTAAAAAAGAATATGATCTT
TTGGTTTATTTAATTAGGAATGAAGGAATAGTAGTTAGTCGCGATAAACTATTAAATAATGTTTGGGGCTATGATTATAC
AGGTGAGACAAATATTGTTGATGTTTATATTCGTTATTTGCGTAGTAAAATTGATGATCCTTTTTCTCAAAAAATAATAC
ATACTGTTAGAGGAGTTGGCTATGTATTGAGGTCAGATAAGAATGTTTGA

Protein sequence :
MDKKILLIEDDSQIARFIELELEHEGYQVTKFDNGYDGINILKEKSFDLLLLDIMLPGLNGMEVCSQIREFSDIPIIMLT
AKSELEDKVKGLDIGADDYLTKPFEIEELLARIRAHLRRDEGNLENENILKTADVEVKLDAHIVKRAGEEIELTKKEYDL
LVYLIRNEGIVVSRDKLLNNVWGYDYTGETNIVDVYIRYLRSKIDDPFSQKIIHTVRGVGYVLRSDKNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 42
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 4e-23 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-40 53
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-43 52
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-43 50
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-34 46
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-38 45
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-32 44
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-40 43
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-35 43
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-35 43
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-33 43
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-33 42
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-35 42
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-31 42
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-30 42
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-38 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-35 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator HE999704.1.gene1202. Protein 5e-31 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-37 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-35 43
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-39 41
Hprae_1473 YP_005836760.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-32 41