Gene Information

Name : LCBD_2899 (LCBD_2899)
Accession : YP_005860934.1
Strain : Lactobacillus casei BD-II
Genome accession: NC_017474
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2823307 - 2824008 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
TTGAAAACAACATTGCTTCTGGTGGAAGATGAAGCGGCTCTGGCGGATTCATTAACAACAGAGTTCGAGTTAGAGAATAT
GTCAGTTATTTGGGCAAAAGACGGCGCGGAGGCATTGACGCTGTTTAAGAACAATGAAGGTAAAATCAATGTCATTATTT
TGGATTGGATGCTGCCTAAACTAGACGGGTTTAGTGTTTTGCGGAAAATCAGACAATCCAGCCAAGTGCCTATTATTATG
TTGACGGCTCGTGATTACATTGGCGACAAGGTGGCTGGACTGACTGGCGGGGCCGATGATTACATCACCAAGCCTTTTGA
AATGGAGGAACTGGTTGCTCGTGTCGAAGTCGCCTTGCGTCACAATCGGCAGGCTGTCTCACCAGCGACTATTTTTCAAG
TCGATGATCTGCTGGTGGATACGGATAACAAACGCGTTCAGCGCGGTGAGGTGATTATGCCATTGACACAGCGGGAATAT
GAGTTGCTTGTCGAACTTGTTGCCCATCAGGACGAAGCTTGTTCGAGGGATGACTTGCTTGCTGCCGTCTGGGGAACCGA
TTTTGACGGTCAGCCTAATATATTGGATGTCTATATCAGAAATTTACGTCATAAAATTGATGATCATTCAGGTAGCAAGA
AACTCATTCATACTGTTCGCGGCGTCGGCTATATGCTCTCGGCTAATGTTGCATCCATTTAG

Protein sequence :
MKTTLLLVEDEAALADSLTTEFELENMSVIWAKDGAEALTLFKNNEGKINVIILDWMLPKLDGFSVLRKIRQSSQVPIIM
LTARDYIGDKVAGLTGGADDYITKPFEMEELVARVEVALRHNRQAVSPATIFQVDDLLVDTDNKRVQRGEVIMPLTQREY
ELLVELVAHQDEACSRDDLLAAVWGTDFDGQPNILDVYIRNLRHKIDDHSGSKKLIHTVRGVGYMLSANVASI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-32 47
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0083 Protein 1e-30 45
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0111 Protein 2e-30 44
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0638 Protein 5e-24 44
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0308 Protein 3e-28 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-30 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-30 42
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 2e-31 42
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0125 Protein 3e-31 42
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-25 41
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family BAC0347 Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 3e-31 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 6e-34 43
LCBD_2899 YP_005860934.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 4e-34 41