Gene Information

Name : HN6_00029 (HN6_00029)
Accession : YP_005863171.1
Strain : Lactobacillus salivarius CECT 5713
Genome accession: NC_017481
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 43580 - 44290 bp
Length : 711 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAGATACTTGTAGTAGATGATGAAAAACCCATCTCAGATATAGTGAAGTTTAATTTAACCAAAGAAGGTTATGA
TGTTTATACAGCCTATGATGGTGAAGAAGCTTTACAACAAGTTAAAGAAGTAGAACCAGACTTAATTTTACTTGACTTGA
TGTTGCCAAAAATTGATGGCTTAGAAGTAGCTCGTGAAGTTCGTAAGACACATGACATGCCAATCATTATGGTAACAGCC
AAGGATTCTGAAATTGATAAGGTTCTAGGTTTGGAATTAGGTGCAGATGACTATGTAACTAAACCTTTCTCTAACCGTGA
ATTAGTAGCTCGTGTTAAAGCCAATTTGCGCCGTCAATCAGCAGTAGCCGCAAAGTCTTCCGCTGAAGATGACAAGAATT
CTGAAATTACTGTTGGTGATTTGACAATTCATCCAGAAGCATACACTGTGTCTAAGAATGGTCAAAGAATTGAATTAACT
CATCGCGAATTTGAGTTATTACATTACTTAGCTCAACATCTAGGTCAAGTTATGACGCGTGAACATTTGTTACAAACAGT
TTGGGGATATGACTACTTTGGTGATGTGCGTACTGTGGACGTAACAGTTCGTCGTTTAAGAGAAAAGATTGAAGATAATC
CTAGTCGTCCAACTTGGTTAGTGACACGTCGTGGTGTAGGTTATTATTTACGCAATCCTGAAGTTGAATAG

Protein sequence :
MKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQVKEVEPDLILLDLMLPKIDGLEVAREVRKTHDMPIIMVTA
KDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRRQSAVAAKSSAEDDKNSEITVGDLTIHPEAYTVSKNGQRIELT
HREFELLHYLAQHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSRPTWLVTRRGVGYYLRNPEVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 3e-24 41
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 4e-24 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 4e-24 41
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-24 41
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 4e-24 41
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HN6_00029 YP_005863171.1 two-component response regulator NC_012469.1.7685629. Protein 3e-71 70
HN6_00029 YP_005863171.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-52 53
HN6_00029 YP_005863171.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-52 52
HN6_00029 YP_005863171.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-52 52
HN6_00029 YP_005863171.1 two-component response regulator HE999704.1.gene2815. Protein 4e-46 50
HN6_00029 YP_005863171.1 two-component response regulator NC_012469.1.7686381. Protein 7e-40 49
HN6_00029 YP_005863171.1 two-component response regulator AE016830.1.gene1681. Protein 3e-46 47
HN6_00029 YP_005863171.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-37 46
HN6_00029 YP_005863171.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-39 46
HN6_00029 YP_005863171.1 two-component response regulator NC_002695.1.915041.p Protein 2e-34 45
HN6_00029 YP_005863171.1 two-component response regulator CP000034.1.gene3834. Protein 2e-34 45
HN6_00029 YP_005863171.1 two-component response regulator CP001918.1.gene5135. Protein 8e-30 45
HN6_00029 YP_005863171.1 two-component response regulator AE000516.2.gene3505. Protein 3e-36 45
HN6_00029 YP_005863171.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-37 45
HN6_00029 YP_005863171.1 two-component response regulator BAC0533 Protein 1e-34 44
HN6_00029 YP_005863171.1 two-component response regulator CP000647.1.gene4257. Protein 1e-34 44
HN6_00029 YP_005863171.1 two-component response regulator CP001138.1.gene4273. Protein 1e-34 44
HN6_00029 YP_005863171.1 two-component response regulator AF162694.1.orf4.gene Protein 4e-34 43
HN6_00029 YP_005863171.1 two-component response regulator CP004022.1.gene3215. Protein 8e-37 43
HN6_00029 YP_005863171.1 two-component response regulator AM180355.1.gene1830. Protein 5e-38 43
HN6_00029 YP_005863171.1 two-component response regulator CP000034.1.gene2186. Protein 2e-31 43
HN6_00029 YP_005863171.1 two-component response regulator BAC0596 Protein 2e-30 43
HN6_00029 YP_005863171.1 two-component response regulator NC_002695.1.916589.p Protein 3e-31 43
HN6_00029 YP_005863171.1 two-component response regulator BAC0039 Protein 2e-31 43
HN6_00029 YP_005863171.1 two-component response regulator CP001138.1.gene2239. Protein 2e-30 43
HN6_00029 YP_005863171.1 two-component response regulator AF130997.1.orf0.gene Protein 2e-36 42
HN6_00029 YP_005863171.1 two-component response regulator CP000647.1.gene2531. Protein 1e-29 42
HN6_00029 YP_005863171.1 two-component response regulator HE999704.1.gene1528. Protein 3e-30 41
HN6_00029 YP_005863171.1 two-component response regulator CP001485.1.gene721.p Protein 8e-29 41
HN6_00029 YP_005863171.1 two-component response regulator NC_005054.2598277.p0 Protein 5e-37 41
HN6_00029 YP_005863171.1 two-component response regulator NC_014475.1.orf0.gen Protein 5e-37 41
HN6_00029 YP_005863171.1 two-component response regulator EU250284.1.orf4.gene Protein 3e-35 41
HN6_00029 YP_005863171.1 two-component response regulator AE015929.1.gene1106. Protein 1e-30 41
HN6_00029 YP_005863171.1 two-component response regulator CP004022.1.gene1676. Protein 3e-26 41
HN6_00029 YP_005863171.1 two-component response regulator CP001918.1.gene3444. Protein 8e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HN6_00029 YP_005863171.1 two-component response regulator VFG1389 Protein 6e-31 45
HN6_00029 YP_005863171.1 two-component response regulator VFG1702 Protein 3e-33 42
HN6_00029 YP_005863171.1 two-component response regulator VFG1386 Protein 6e-35 42
HN6_00029 YP_005863171.1 two-component response regulator VFG1563 Protein 5e-33 41