Gene Information

Name : HN6_00478 (HN6_00478)
Accession : YP_005863546.1
Strain : Lactobacillus salivarius CECT 5713
Genome accession: NC_017481
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 568150 - 568836 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAGCAGAATTTTAATAATTGAGGACGAAAAAAATTTATCTCGTTTTGTTGAACTTGAATTACAACATGAAGGATACGA
GACAGAAGTATGTAAAAATGGACGACAAGGTTTAGAATTGGCACTGGACGAAGATTGGGATGCCATTTTATTAGATTTAA
TGTTACCTGAATTAAATGGTTTGGAAGTTTGTCGTCGTGTTCGTCAAGTGAAGAATACACCAATTATCATGATGACTGCA
AGAGATTCAGTTATCGACAGAGTTTCAGGTCTAGATCATGGGGCAGATGACTATATTGTAAAACCATTTGCTATTGAAGA
ATTACTAGCAAGATTAAGAGCCGTTTTGCGTCGTGTAGAGCTAGAAAATGAACAAAATGGAAATAAACAAACAACACTAA
CATATCGCGACTTAACTATTGAAAAGGAAAATAGAGTTGTAAGACGTGGAGATGAAATCATAGAATTAACTAAGAGAGAG
TATGAACTACTATTAACGTTGATGGAAAATATAAATGTTGTTTTAGCTAGAGATACACTTTTGAAGAAAGTATGGGGATA
TGAAACACAAATAGAAACAAATGTTGTGGATGTTTATATCCGTTATTTACGTAATAAGATTGATCGTCCTGGAGAAGACA
GCTATATCCAAACAGTTCGTGGTACTGGATACGTAATGCGTTCCTAA

Protein sequence :
MSRILIIEDEKNLSRFVELELQHEGYETEVCKNGRQGLELALDEDWDAILLDLMLPELNGLEVCRRVRQVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRAVLRRVELENEQNGNKQTTLTYRDLTIEKENRVVRRGDEIIELTKRE
YELLLTLMENINVVLARDTLLKKVWGYETQIETNVVDVYIRYLRNKIDRPGEDSYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-30 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HN6_00478 YP_005863546.1 two-component response regulator HE999704.1.gene1528. Protein 5e-82 75
HN6_00478 YP_005863546.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-46 53
HN6_00478 YP_005863546.1 two-component response regulator AE015929.1.gene1106. Protein 1e-43 52
HN6_00478 YP_005863546.1 two-component response regulator BAC0308 Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HN6_00478 YP_005863546.1 two-component response regulator VFG0596 Protein 2e-30 44
HN6_00478 YP_005863546.1 two-component response regulator VFG1390 Protein 7e-39 43
HN6_00478 YP_005863546.1 two-component response regulator VFG1389 Protein 4e-31 41