Gene Information

Name : arsC (PAJ_1223)
Accession : YP_005934099.1
Strain : Pantoea ananatis AJ13355
Genome accession: NC_017531
Putative virulence/resistance : Resistance
Product : arsenate reductase ArsC
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1465492 - 1465920 bp
Length : 429 bp
Strand : -
Note : similar to Klebsiella pneumoniae, arsenate reductase (NCBI: YP_002287000.1) COG: inorganic ion transport and metabolism subcellular localization as predicted by Psort 2.0: unknown

DNA sequence :
ATGACTAACATCATCATTTACCACAACCCGGCCTGTGGGACGTCGCGTAACGCCCTGGCGCTTATCCGCAACAGTGGCGT
GGAGCCAACAGTGATTTTATATCTGGAGACGCCACCCTCCCGCGACGAGCTTAAAAAACGGATAGCGGATATGGGGATCC
GCGTGCGCGATCTGCTGCGCAAAAACACAGAGCCGTATGAACATCTGGGGCTGGCCGAAGATCGGTTCAATGATGATGAA
CTGCTGGATGCTATGCTGGCTCATCCTGTCCTCATCAACCGTCCGATAGTCGTGACGCCGCTCGGCACAAGGCTCTGTCG
TCCGTCTGAGGCCGTTCTGGGCATTCTGCCTGAGTCACAGAAGGGAGCCTTTACGAAAGAGGATGGCGAAAAAGTTATTG
ATGAGTACGGCAACCGGACCGGTCACTGA

Protein sequence :
MTNIIIYHNPACGTSRNALALIRNSGVEPTVILYLETPPSRDELKKRIADMGIRVRDLLRKNTEPYEHLGLAEDRFNDDE
LLDAMLAHPVLINRPIVVTPLGTRLCRPSEAVLGILPESQKGAFTKEDGEKVIDEYGNRTGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 5e-51 80
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 4e-39 63
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 6e-39 63
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 8e-39 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsC YP_005934099.1 arsenate reductase ArsC BAC0582 Protein 4e-52 80
arsC YP_005934099.1 arsenate reductase ArsC BAC0583 Protein 6e-52 79
arsC YP_005934099.1 arsenate reductase ArsC BAC0584 Protein 6e-51 79
arsC YP_005934099.1 arsenate reductase ArsC BAC0585 Protein 6e-49 76