Gene Information

Name : irlR (PSTAA_3275)
Accession : YP_005939886.1
Strain : Pseudomonas stutzeri DSM 4166
Genome accession: NC_017532
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3468888 - 3469562 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGCGAATTCTGGTGGTGGAGGACGAGGCCAAGACGGCCGACTACCTCAAGCGAGGGTTGGAGGAGTCCGGCTACCGGGT
GGAGGTCGCGCGCAACGGCGTCGACGGCAAACACCTGATCGAGGAGGAAACGTTCGATCTGGTAATCCTCGACGTCATGC
TGCCCGGGCTCGATGGCTGGCAGCTGGTGCAGGTGGTGCGCCAGCGCTCGGCGCACACGCCGGTGCTGTTCCTCACTGCC
CGCGATGCGGTGGAAGACCGGGTGCGCGGGCTGGAACTGGGCGCCGACGACTACCTCATCAAACCCTTTTCCTACGCCGA
GCTGCTGGCGCGGGTGCGCACGCTGCTGCGTCGCGGCCCGCCGCGGGAAGTCGAGCATTTCCACGTTGCCGACCTGGAGC
TGGACCTGCTGCGCCGCCGCGTCACCCGTCAGGGCGAGCGCATCAACCTGACCAACAAGGAGTTCGCCTTGCTGCACCTG
CTGCTCAGCCGTCAGGGCGAGGTGCTTTCCCGTGCGCAGATCGCTTCGCAGGTCTGGCAGATGAACTTCGACAGCGATAC
CAATGTGGTCGACGTGGCGATCCGCCGGCTGCGCGCCAAGGTCGACGATCCGTACCCGCTCAAACTCATCCACACCGTGC
GCGGCATGGGCTACGTGCTGGACGTCTCGGCATGA

Protein sequence :
MRILVVEDEAKTADYLKRGLEESGYRVEVARNGVDGKHLIEEETFDLVILDVMLPGLDGWQLVQVVRQRSAHTPVLFLTA
RDAVEDRVRGLELGADDYLIKPFSYAELLARVRTLLRRGPPREVEHFHVADLELDLLRRRVTRQGERINLTNKEFALLHL
LLSRQGEVLSRAQIASQVWQMNFDSDTNVVDVAIRRLRAKVDDPYPLKLIHTVRGMGYVLDVSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_005939886.1 two-component response regulator BAC0125 Protein 3e-71 67
irlR YP_005939886.1 two-component response regulator BAC0197 Protein 2e-69 65
irlR YP_005939886.1 two-component response regulator BAC0638 Protein 1e-61 64
irlR YP_005939886.1 two-component response regulator BAC0083 Protein 2e-68 62
irlR YP_005939886.1 two-component response regulator BAC0308 Protein 6e-64 59
irlR YP_005939886.1 two-component response regulator BAC0111 Protein 3e-67 58
irlR YP_005939886.1 two-component response regulator BAC0347 Protein 2e-59 54
irlR YP_005939886.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-36 45
irlR YP_005939886.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-36 45
irlR YP_005939886.1 two-component response regulator AE000516.2.gene3505. Protein 9e-28 44
irlR YP_005939886.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-37 43
irlR YP_005939886.1 two-component response regulator HE999704.1.gene1528. Protein 5e-28 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_005939886.1 two-component response regulator VFG0596 Protein 8e-59 57
irlR YP_005939886.1 two-component response regulator VFG1389 Protein 1e-35 46
irlR YP_005939886.1 two-component response regulator VFG1390 Protein 1e-42 45
irlR YP_005939886.1 two-component response regulator VFG1386 Protein 1e-35 42