Gene Information

Name : ompR (LMM7_1593)
Accession : YP_005947656.1
Strain : Listeria monocytogenes M7
Genome accession: NC_017537
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1551102 - 1551788 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAATTACTTATGATAGAAGATAATGTAAGTGTTTGTGAAATGATAGAAATGTTCTTTATGAAAGAAGAAATTGACGC
TACGTTCGTTCATGACGGCAAGCAAGGTTATGAAGCGTTTTTTAAAGATGAATATGATATTGCAATTATTGACTTAATGC
TTCCTAATATGGACGGTATGACCATTTGCCGTAAAATTCGTGAAGTAAGCGATGTGCCAATTATCATTTTAACGGCTAAG
GAGTCAGAATCCGATCAAGTACTTGGTCTCGAAATGGGTGCGGATGATTATGTAACTAAACCATTTAGCCCACTTACCTT
AATGGCCCGAATTAAAGCAGTGACACGTCGAAAAAATAGCGCCTCTCCTGCAGAAAACAATGAAGATATTTTAGAAACGA
CTTATTTTAAAATTAGTAAACGAACACGCGAAATTTTTTATCAAGGAGAGCTCCTTGATGCTCTAACACCAAAAGAATTC
GATTTACTCTATTTTTTAATGCAACATCCACGGCAAGTATTTTCAAGAGAGCAATTGTTAGAACAGGTTTGGGGCTATCA
ATTTTACGGAGATGAGCGCACCGTTGATGTTCATATTAAACGTTTACGCCAAAAAATCGCCACCGAAACAAAGCCATTTT
TGCACACCGTCTGGGGTGTCGGCTACAAATTTGATGAAACGGAATGA

Protein sequence :
MKLLMIEDNVSVCEMIEMFFMKEEIDATFVHDGKQGYEAFFKDEYDIAIIDLMLPNMDGMTICRKIREVSDVPIIILTAK
ESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNSASPAENNEDILETTYFKISKRTREIFYQGELLDALTPKEF
DLLYFLMQHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATETKPFLHTVWGVGYKFDETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_005947656.1 putative two-component response regulator NC_010400.5986590.p0 Protein 6e-38 45
ompR YP_005947656.1 putative two-component response regulator DQ212986.1.gene4.p01 Protein 2e-31 44
ompR YP_005947656.1 putative two-component response regulator CP001918.1.gene3444. Protein 2e-29 44
ompR YP_005947656.1 putative two-component response regulator NC_012469.1.7685629. Protein 1e-38 43
ompR YP_005947656.1 putative two-component response regulator AE015929.1.gene1106. Protein 4e-29 43
ompR YP_005947656.1 putative two-component response regulator NC_012469.1.7686381. Protein 4e-41 43
ompR YP_005947656.1 putative two-component response regulator FJ349556.1.orf0.gene Protein 1e-37 43
ompR YP_005947656.1 putative two-component response regulator BAC0039 Protein 5e-29 43
ompR YP_005947656.1 putative two-component response regulator CP000034.1.gene2186. Protein 5e-29 43
ompR YP_005947656.1 putative two-component response regulator NC_002695.1.916589.p Protein 5e-29 43
ompR YP_005947656.1 putative two-component response regulator CP000647.1.gene2531. Protein 2e-28 43
ompR YP_005947656.1 putative two-component response regulator NC_011595.7057856.p0 Protein 4e-38 42
ompR YP_005947656.1 putative two-component response regulator NC_010410.6002989.p0 Protein 4e-38 42
ompR YP_005947656.1 putative two-component response regulator AE016830.1.gene1681. Protein 8e-40 42
ompR YP_005947656.1 putative two-component response regulator HE999704.1.gene2815. Protein 1e-43 42
ompR YP_005947656.1 putative two-component response regulator NC_002951.3238224.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_007793.3914065.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_002758.1121390.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_010079.5776364.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_002952.2859858.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_007622.3794948.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_003923.1003417.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator NC_013450.8614146.p0 Protein 1e-32 42
ompR YP_005947656.1 putative two-component response regulator AM180355.1.gene1830. Protein 3e-31 42
ompR YP_005947656.1 putative two-component response regulator NC_005054.2598277.p0 Protein 5e-35 42
ompR YP_005947656.1 putative two-component response regulator NC_014475.1.orf0.gen Protein 5e-35 42
ompR YP_005947656.1 putative two-component response regulator CP001138.1.gene2239. Protein 6e-28 42
ompR YP_005947656.1 putative two-component response regulator BAC0596 Protein 6e-28 42
ompR YP_005947656.1 putative two-component response regulator AE000516.2.gene3505. Protein 4e-34 41
ompR YP_005947656.1 putative two-component response regulator AF155139.2.orf0.gene Protein 4e-35 41
ompR YP_005947656.1 putative two-component response regulator AF130997.1.orf0.gene Protein 5e-29 41
ompR YP_005947656.1 putative two-component response regulator CP000034.1.gene3671. Protein 7e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_005947656.1 putative two-component response regulator VFG1563 Protein 4e-35 47
ompR YP_005947656.1 putative two-component response regulator VFG1702 Protein 7e-35 47