Gene Information

Name : LMKG_00839 (LMKG_00839)
Accession : YP_005968344.1
Strain : Listeria monocytogenes FSL R2-561
Genome accession: NC_017546
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1422935 - 1423615 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAATAGAATACTAATCGTAGAAGATGAAAAAAACTTAGCACGCTTTATTGAACTAGAACTCCAGCATGAAAATTATGA
AACAGCGGTTGCTAATGATGGACGCGCTGGACTCGAACTCGCACTTAATGAAGAATGGGATGCTATTTTACTCGATCTAA
TGTTGCCACATTTAAACGGGGTAGAAGTTTGTCGTCGTGTGCGCCAAGTGAAACAAACACCCATTATTATGATAACCGCA
CGTGACTCTGTTATCGATCGTGTATCCGGACTGGATCACGGAGCAGATGATTACATCGTCAAACCTTTCGCTATTGAAGA
ATTACTTGCGCGCCTTCGCTCGCTATTGCGTCGGGTGGAAAATGCAGAACAATCTGCTAAACAAACAACGCTACAGTATC
GTAATCTAATTGTTGAAAAGGAAAATCGCATTGTCAAACGCGACGAAGAAATCATTGACTTAACAAAACGAGAGTATGAA
CTTTTACTTACGTTAATGGAAAATGTTAATATCGTTCTTACGCGGGAAGTGTTACTCAATAAAGTATGGGGTTATGAAAC
AGAAGTAGAAACAAATGTAGTGGATGTGTACGTTCGTTACTTACGAAATAAAATTGATCATCCTGACGAAGAAAGTTATA
TTCAAACAGTTCGCGGGACAGGGTATGTGATGCGTACATGA

Protein sequence :
MNRILIVEDEKNLARFIELELQHENYETAVANDGRAGLELALNEEWDAILLDLMLPHLNGVEVCRRVRQVKQTPIIMITA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRSLLRRVENAEQSAKQTTLQYRNLIVEKENRIVKRDEEIIDLTKREYE
LLLTLMENVNIVLTREVLLNKVWGYETEVETNVVDVYVRYLRNKIDHPDEESYIQTVRGTGYVMRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LMKG_00839 YP_005968344.1 two-component system response regulator HE999704.1.gene1528. Protein 3e-94 100
LMKG_00839 YP_005968344.1 two-component system response regulator AE015929.1.gene1106. Protein 3e-47 56
LMKG_00839 YP_005968344.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-49 55
LMKG_00839 YP_005968344.1 two-component system response regulator BAC0308 Protein 2e-31 43
LMKG_00839 YP_005968344.1 two-component system response regulator BAC0125 Protein 5e-31 42
LMKG_00839 YP_005968344.1 two-component system response regulator NC_012469.1.7685629. Protein 7e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LMKG_00839 YP_005968344.1 two-component system response regulator VFG1390 Protein 6e-40 44
LMKG_00839 YP_005968344.1 two-component system response regulator VFG1389 Protein 5e-32 43
LMKG_00839 YP_005968344.1 two-component system response regulator VFG1563 Protein 2e-31 41
LMKG_00839 YP_005968344.1 two-component system response regulator VFG1702 Protein 1e-31 41