Gene Information

Name : NCGM2_1439 (NCGM2_1439)
Accession : YP_005979690.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1582919 - 1583131 bp
Length : 213 bp
Strand : -
Note : similar to AA sequence:RefSeq:YP_001565168; similar to hypothetical protein Daci_4152 [Delftia acidovorans SPH-1]

DNA sequence :
ATGTCCCACAAAGCCTCTTTCAGCCAGTTGGCCTTGACCTATTGCGGCAAGTTCCTGCCGCTCGAAGTCCTGCAAAGCGC
CGCCGGCCACTACATCGGCACGCGCGATACCGAAGGTCCCGTTTCGCGGGAATCGCACGAGTACTTCCGCAGCCATGCGG
CGGCTCAACGTGCCCTCGAAAGAGGCGGCTGGTCCCAGCTCGCCATTCCCTGA

Protein sequence :
MSHKASFSQLALTYCGKFLPLEVLQSAAGHYIGTRDTEGPVSRESHEYFRSHAAAQRALERGGWSQLAIP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
t4236 NP_807838.1 hypothetical protein Not tested SPI-7 Protein 4e-11 58
STY4535 NP_458626.1 hypothetical protein Not tested SPI-7 Protein 4e-11 58
unnamed ABR13413.1 hypothetical protein Not tested PAGI-5 Protein 6e-09 57
RL072 AAP84197.1 conserved hypothetical protein Not tested PAPI-1 Protein 1e-08 50